KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0853Help
Entry
SeD_A0853         CDS       T00757                                 

Definition
(GenBank) zinc transporter ZitB
  KO
K16264  cobalt-zinc-cadmium efflux system protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Transporters [BR:sed02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SeD_A0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cation_efflux ZT_dimer
Motif
Other DBs
NCBI-ProteinID: ACH74979
Position
complement(846201..847139)
Genome map
AA seq 312 aa AA seqDB search
MAHSHSHADSHLPKDNNARRLLFAFIVTAGFMLLEVVGGILSGSLALLADAGHMLTDAAA
LLFALLAVQFSRRPPTVRHTFGWLRLTTLAAFVNAIALVVITLLIVWEAIERFYTPRPVA
GNLMMVIAVAGLLANLFAFWILHRGSDEKNLNVRAAALHVMGDLLGSVGAIVAALIIIWT
GWTPADPILSILVSVLVLRSAWRLLKDSVNELLEGAPVSLDINALQRHLSREIPEVRNVH
HVHVWMVGEKPVMTLHAQVIPPHDHDALLERIQDFLMHEYHIAHATIQMEYQVCHGPDCH
LNQTPSGHVHHH
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactcacactctcatgccgattcacacctgccgaaagataataatgctcgtcgc
ctgcttttcgcctttatcgtcactgccggatttatgctccttgaggtggtgggcgggata
ctctccggctctctggcgttgttggcggatgcgggacatatgctcaccgacgcggcggcc
cttctttttgcgctgctggcggttcaattttcccgtcgtcccccgactgttcgccacact
tttggctggctaagactcaccacactggcggcttttgtgaatgccattgcgttggtggtc
attacccttctcattgtctgggaagcgatagagcgcttttacacgccacgtccggtggcg
ggcaatctgatgatggtaattgcggttgcgggtctgctggcgaacctgtttgcgttctgg
atactccatcggggaagcgatgaaaaaaacctgaacgtgcgcgctgccgcgctacatgtg
atgggcgatttgctgggttccgtcggcgcaatagtcgccgcgttgatcattatctggacg
ggctggacgccagcggacccgattctctctattctggtttcggtactggtactacgcagc
gcctggcgtttgttaaaagatagcgtcaacgaattgctggaaggcgcgccggtttcactg
gatattaatgccttacagcgccatttaagccgggaaatccccgaagtccgcaacgtacac
catgtgcatgtctggatggtcggcgaaaaaccggtcatgacattgcacgctcaggtcatt
ccgccacacgaccatgatgcgctgctggaacgtatccaggatttcctgatgcacgaatac
catattgcgcacgctacgattcagatggagtatcaagtgtgtcacggcccggactgtcat
ctgaatcagacgccatccgggcatgttcatcaccattaa

DBGET integrated database retrieval system