KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0859Help
Entry
SeD_A0859         CDS       T00757                                 

Definition
(GenBank) transcriptional regulator
  KO
K21645  LysR family transcriptional regulator, hypochlorite-specific transcription factor HypT
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Transcription factors [BR:sed03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    SeD_A0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_1 LysR_substrate Secretin_N_2
Motif
Other DBs
NCBI-ProteinID: ACH75754
Position
complement(851527..852474)
Genome map
AA seq 315 aa AA seqDB search
MLIRLQLMQYRHHLELTWLEDCLALKETLNFSKASASRYVTQPAFSRRIQSLEEWVGTPL
FERSKRGVTLTKAGEVFTDQLPELIHSLYTLKSDTLEAAGNKQPSLVFSATHALSFSFVP
HLLKQSDKIAKFGSFRLLSDSLNACEKMMRQGDSQFLLCHHHPHMHLNLNKNHFMSIRLG
FDTLIPFSKPDSETLKPLWNINNKIQFPYLSFSSQSGLGRIIANTASINRITHNINVAFV
ADLAATLLAMVRSGDGVAWIPQSLARQDIEAKTIVTAAEKESNLWVPIEIRLYRPAKRMP
PDAEELWEIFVEEQI
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgctaataaggttgcagcttatgcaatatcggcatcacctcgaactaacatggctcgaa
gactgtctggctctaaaagaaacgttgaatttctcaaaagcgtctgcctcaagatatgtg
actcaacccgcatttagtcgtcggatacaatctctcgaagaatgggtgggtacgcccctt
tttgaaagaagtaaacggggagtcacccttaccaaggccggagaagtatttacagaccag
cttcccgaactgatccactccttgtacacattgaaaagtgatacccttgaggctgcaggt
aataaacaacctagtcttgttttttcagcaacgcatgctttgtctttctcttttgtaccg
cacttgttaaagcaaagtgataaaattgcaaaatttggttcatttcgtcttttatctgac
tcattgaatgcgtgcgaaaaaatgatgcggcagggagattcacaatttttgctgtgtcac
catcacccacatatgcatctaaatttaaataaaaatcactttatgagcattcgtcttggg
tttgatacattaattccattcagtaaaccagactcagaaacgttaaaaccgttgtggaat
ataaataataagattcaattcccttacctttctttttcatcacaatcaggtctgggaaga
ataatagcaaatacagcgtctattaacagaattacccataatataaatgttgcctttgtg
gccgatctggcagcaacactattggcaatggtcagatctggcgatggtgttgcctggata
cctcaaagccttgccaggcaagatatagaggctaaaactattgttactgcagcggaaaaa
gaaagcaatttatgggtacccatagaaataagactttatagaccagccaagagaatgcct
ccagatgccgaagagctatgggaaatttttgttgaagaacaaatataa

DBGET integrated database retrieval system