KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0867Help
Entry
SeD_A0867         CDS       T00757                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00010  Glycolysis / Gluconeogenesis
sed00260  Glycine, serine and threonine metabolism
sed00680  Methane metabolism
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
sed01120  Microbial metabolism in diverse environments
sed01130  Biosynthesis of antibiotics
sed01200  Carbon metabolism
sed01230  Biosynthesis of amino acids
Module
sed_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sed_M00002  Glycolysis, core module involving three-carbon compounds
sed_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeD_A0867 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SeD_A0867 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SeD_A0867 (gpmA)
Enzymes [BR:sed01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SeD_A0867 (gpmA)
Membrane trafficking [BR:sed04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SeD_A0867 (gpmA)
Exosome [BR:sed04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SeD_A0867 (gpmA)
  Exosomal proteins of melanoma cells
   SeD_A0867 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACH74611
UniProt: B5FP39
Position
complement(860544..861296)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGISEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcataagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggtgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaagcagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagattcttgagttaaacatcccaaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgatcaaacattactatctgggcaacgctgacgagatcgctgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system