KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0867Help
Entry
SeD_A0867         CDS       T00757                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SeD_A0867 (gpmA)
   01230 Biosynthesis of amino acids
    SeD_A0867 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeD_A0867 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SeD_A0867 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SeD_A0867 (gpmA)
Enzymes [BR:sed01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SeD_A0867 (gpmA)
Exosome [BR:sed04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SeD_A0867 (gpmA)
  Exosomal proteins of melanoma cells
   SeD_A0867 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(860544..861296)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGISEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcataagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggtgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaagcagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagattcttgagttaaacatcccaaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgatcaaacattactatctgggcaacgctgacgagatcgctgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system