KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0882Help
Entry
SeD_A0882         CDS       T00757                                 

Gene name
hutI
Definition
(GenBank) imidazolonepropionase
  KO
K01468  
imidazolonepropionase [EC:3.5.2.7]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Histidine metabolism
Metabolic pathways
Module
Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SeD_A0882 (hutI)
Enzymes [BR:sed01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.7  imidazolonepropionase
     SeD_A0882 (hutI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
876022..877245
Genome map
AA seq 407 aa AA seqDB search
MRQLLPGDTVWRNIRLATMDPQRQAPYGLVDNQALIVREGHICDIVPETQLPVSGDNIHD
MQGRLVTPGLIDCHTHLVFAGNRAAEWEQRLNGASYQHISAQGGGINATVSATRACAEET
LYLLARERMMRLASEGVTLLEIKSGYGLELATEEKLLRVAAKLAAENAIDISPTLLAAHA
TPAEYRDDPDGYITLVCETMIPQLWQKGLFDAVDLFCESVGFNVAQSERVLQTAKALGIP
VKGHVEQLSLLGGAQLVSRYQGLSADHIEYLDEAGVAAMRDGGTVGVLLPGAFYFLRETQ
RPPVELLRRYQVPVAVASDFNPGTSPFCSLHLAMNMACVQFGLTSEEAWAGVTRHAARAL
GRQATHGQLRADYRADFVVWDAEQPVEVVYEPGRNPLYQRVYRGQIS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaacttttaccgggcgatactgtctggcgaaacatcaggctggcgacaatggac
ccgcagcggcaagccccgtacgggctggtggataaccaggcgctgattgtacgcgaaggg
catatttgcgatatcgtgccagagacgcagcttcctgtcagtggggacaatatccatgat
atgcagggacgactggtaaccccgggacttatcgattgccacacgcatctggtgtttgcc
ggtaaccgcgccgcagagtgggagcagcggcttaacggcgcgtcataccagcatattagc
gctcagggcggcggcattaacgcgacggtatcagcaacccgcgcctgtgcggaggagacg
ctctacctgctggcgcgcgaacgcatgatgcgccttgccagcgaaggcgttacgctgctg
gagattaaatccggctatggcctggagctggcgacagaagaaaagctgttgcgcgttgct
gcaaaacttgccgccgaaaacgctatcgacattagccccacgctattggccgctcatgct
acgccagcggagtatcgtgacgacccggacggctacatcactctggtctgcgagacgatg
attccgcagctctggcaaaaagggttatttgatgcggtagacctcttttgcgagagcgtc
ggctttaatgtggcgcagagtgagcgcgtattgcagacggcgaaggcgttaggtattccc
gttaaaggccatgttgagcagctttcgctgttgggcggcgcgcagctggtgagtcgctat
cagggtttatcggcggatcatatcgaatatcttgatgaagcgggcgtcgcggcgatgcgt
gacggcggtactgtcggcgtgttgttgcctggcgcgttttattttctgcgcgagacgcag
cgcccgccggtggaactgctgcgccgctatcaggtgcctgtcgccgtcgccagcgatttc
aatcccggcaccagcccgttttgcagtttgcatctggcgatgaatatggcctgcgtacag
tttggtctgacgtcggaagaggcatgggcgggcgttacgcgccatgccgctcgtgcgctg
ggaagacaggcgacgcatgggcagctcagggccgactaccgggcggattttgtggtgtgg
gatgctgaacagccggtagaggttgtgtatgagccggggcgtaatcctttatatcagcgg
gtatacagaggacaaatctcatga

DBGET integrated database retrieval system