KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0883Help
Entry
SeD_A0883         CDS       T00757                                 

Gene name
hutG
Definition
(GenBank) formimidoylglutamase
  KO
K01479  formiminoglutamase [EC:3.5.3.8]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00340  Histidine metabolism
sed01100  Metabolic pathways
Module
sed_M00045  Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SeD_A0883 (hutG)
Enzymes [BR:sed01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.8  formimidoylglutamase
     SeD_A0883 (hutG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ACH75619
UniProt: B5FP55
Position
877242..878183
Genome map
AA seq 313 aa AA seqDB search
MTQWYPASPALWQGRDDSIEAPDARRLFQTVTRSETFSPENWQQKIALMGFACDEGVKRN
AGRPGAAGAPDALRKALANMASHQGHERLVDLGNWVAPTPDLEGAQQALRDAVSRCLRAG
MRTLVLGGGHETAFGHGAGVLDAFAQESVGIINLDAHLDLRQTDRATSGTPFRQLAQLCD
AQSRAFHYACFGVSRAANTQALWREAQWRNVTVVEDLDCHDALAQMTQFIDKVDKIYLTI
DLDVLPVWEMPAVSAPAALGVPLIQVLRLIEPVCRSGKLQAADLVEFNPRFDEDGAAARV
AARLGWQIAHWWR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatggtatccggcttctccggcgctctggcaggggcgcgatgacagtatagaa
gcgccggatgcgcggcgtctgtttcagaccgtcacgcgcagcgagaccttttcccccgaa
aactggcagcaaaagatcgcgttaatgggatttgcctgcgacgagggggtaaaacgcaat
gcagggcgtcccggcgcggcaggcgccccggatgcgttgcgtaaagcgctggcgaatatg
gccagccaccagggacatgaacggctagtggatttaggcaattgggttgcgcctacgccc
gatctggaaggcgcgcagcaggccttgcgcgatgcggtaagccgctgtctgcgggccggg
atgcgcacgctggtgctgggcggtgggcatgaaaccgcgtttggacacggcgcgggggtg
ctggacgcgtttgcgcaggaaagcgtaggtatcattaatcttgatgcgcatctggatctc
cgtcagaccgaccgggcaacatccgggacgccgtttcgtcaactggcgcagctatgcgac
gcgcagagccgcgcgtttcattatgcctgtttcggcgtgagccgtgcggcgaatacgcag
gcgttgtggcgggaagcgcagtggcggaatgttaccgtggtggaggatcttgactgccat
gacgcgctggcgcagatgacgcagtttatcgacaaggtggataaaatttatctgactatc
gatctcgacgtattgcctgtctgggaaatgccggccgtctccgctcccgcagcgctgggc
gtgccgctgatacaggttctgcgtttaattgagccggtttgccgcagcggaaaattacag
gcggcggatctggttgagtttaatccacgctttgatgaagatggcgcagcggcgcgcgtg
gcggcgcggcttggctggcaaatcgcgcactggtggcgttaa

DBGET integrated database retrieval system