KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0899Help
Entry
SeD_A0899         CDS       T00757                                 

Gene name
moaD
Definition
(GenBank) molybdopterin converting factor, subunit 1
  KO
K03636  sulfur-carrier protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sed00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    SeD_A0899 (moaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiS
Motif
Other DBs
NCBI-ProteinID: ACH75748
Position
896793..897038
Genome map
AA seq 81 aa AA seqDB search
MIKVLFFAQVRELTGTDALDLPADFSTVESLRQHLATKSDRWALALEDGKLLAAVNQTLV
SFDHPLTAGDEVAFFPPVTGG
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggtgcttttcttcgcccaggttcgcgagcttacaggaactgatgcgctggat
cttccagcagatttttccaccgttgagtcgctgcgacagcatctggcgacaaagagcgat
cgttgggcgctggcgctggaagacggtaagctgttggcggcggtcaaccagacgctggta
agttttgaccatccgctgacggcgggcgatgaagtggcgtttttcccgccagtcacgggg
ggctaa

DBGET integrated database retrieval system