KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0923Help
Entry
SeD_A0923         CDS       T00757                                 

Gene name
glnQ
Definition
(GenBank) glutamine ABC transporter, ATP-binding protein
  KO
K10038  glutamine transport system ATP-binding protein [EC:3.6.3.-]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed02010  ABC transporters
Module
sed_M00227  Glutamine transport system
Brite
KEGG Orthology (KO) [BR:sed00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SeD_A0923 (glnQ)
Enzymes [BR:sed01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     SeD_A0923 (glnQ)
Transporters [BR:sed02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamine transporter [MD:M00227] [OT]
    SeD_A0923 (glnQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_29 AAA_23 ABC_ATPase AAA_15 RsgA_GTPase AAA_22 AAA_13 AAA_18 AAA_33 AAA_30 RNA12 AAA_25 CobU ATPase_2 IstB_IS21 cobW NB-ARC NACHT AAA_28 NTPase_1 SbcCD_C T2SSE AAA_24 AAA_27 Rad17 AAA_19 AAA_14 MMR_HSR1 Sigma54_activat Adeno_IVa2 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: ACH77490
Position
complement(918887..919609)
Genome map
AA seq 240 aa AA seqDB search
MIEFKNVSKHFGPTQVLHNIDLNIRQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIV
DGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVMFGPLRVRGVKKEEAEKQAKAL
LAKVGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEPTSALDPELRHEVLKVMQ
DLAEEGMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGSPQALIENPPSPRLQEFLQHVS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaatttaaaaacgtctccaagcactttggccccacccaggtgctacataacatt
gatttaaacatccgtcagggcgaagtggttgtgattatcggcccttccggttcgggtaaa
tccacgttattacgctgtatcaataaactggaagagatcacctccggtgatctgattgtc
gatggtctgaaagtcaacgatcctaaagtagacgaacggctgattcgccaggaagccggc
atggtgtttcaacagttttatctgttcccgcatctgaccgcgctcgaaaacgtaatgttc
ggtcctctgcgcgtgcgcggcgtaaagaaagaagaagcggaaaaacaggcgaaagctctg
ttagcgaaagttggactggcggaacgggcgcatcactacccctccgagctttccggcggt
caacaacagcgcgtcgccattgcccgagcgctggcagtgaagccgaaaatgatgctcttt
gacgagccaacctccgctctggaccctgaactgcgccatgaagtgctgaaagtcatgcag
gatctggcggaagaaggcatgaccatggtcattgtcactcacgaaatcggctttgccgaa
aaagtcgcctcacggctgattttcatcgataaaggccgtattgccgaagatggcagtccg
caggcgttgatcgaaaacccgccaagcccacgtttacaggaatttttacagcacgtctcc
tga

DBGET integrated database retrieval system