KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0926Help
Entry
SeD_A0926         CDS       T00757                                 

Definition
(GenBank) DNA protection during starvation protein
  KO
K04047  starvation-inducible DNA-binding protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Chromosome and associated proteins [BR:sed03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    SeD_A0926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferritin IQ_SEC7_PH Tht1
Motif
Other DBs
NCBI-ProteinID: ACH73818
UniProt: B5FP96
Structure
PDB: 

Jmol
Position
complement(921632..922135)
Genome map
AA seq 167 aa AA seqDB search
MSTAKLVKTKASNLLYTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFI
AVHEMLDGFRTALTDHLDTMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKE
LADRYAVVANDVRKAIGEAKDEDTADIFTAASRDLDKFLWFIESNIE
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgctaaactggtaaaaacaaaagcgtctaatctgctttatacccgtaacgat
gtatcagagagcgataaaaaagcgacggttgagttgcttaatcgtcaggtgatccagttc
attgacctgtcgctgatcacgaaacaggcccactggaacatgcgcggtgctaactttatt
gccgttcatgagatgctggatggcttccgtaccgcactgaccgatcatctggatactatg
gccgagcgtgccgtacagcttggcggtgtggcgttaggcaccacgcaagttatcaacagc
aaaactccactgaaaagctatccgctcgacatccataacgtgcaggatcacttaaaagaa
ctggccgatcgctacgctgttgtcgctaatgatgttcgcaaagctattggtgaagccaaa
gatgaagacactgccgatatctttaccgccgcatcacgcgacctcgataaattcctgtgg
tttatcgaatccaacatcgaataa

DBGET integrated database retrieval system