KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0928Help
Entry
SeD_A0928         CDS       T00757                                 

Definition
(GenBank) threonine/homoserine efflux transporter RhtA
  KO
K11939  inner membrane transporter RhtA
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Transporters [BR:sed02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SeD_A0928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA
Motif
Other DBs
NCBI-ProteinID: ACH77005
Position
complement(922438..923298)
Genome map
AA seq 286 aa AA seqDB search
MPGSTRKLPVWLPILVLLIAMSSIQSGASLAKSLFPLVGAPGVTALRLALGTLILIAFFK
PWRLRFAKEQRLPLLFYGLSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV
DFIWVVLAVLGLWFLLPLGQDMSHVDLTGAALALGAGACWAVYILTGQRAGAEHGPATVA
VGSLIAAIIFVPIGAVQAGDALWHWSILPLGLAVAVLSTALPYSLEMIALTRLPTRTFGT
LMSMEPALGETLTGIQILALCAIIAASMGSTLTIRREPQIKQVDVK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccggggtcaacacgtaaactaccagtctggttgcccattttggttttgctcattgcc
atgtcctctattcagagtggcgcttcactggcaaaatcgttatttcctcttgtcggcgcg
ccgggcgtaacggcgcttcgtctggcgttgggaacgcttatccttatcgcctttttcaaa
ccctggcgtttgcgttttgccaaagagcagcggctgcctttactgttttatggtctgtcg
ctgggcgggatgaactatctattctatctgtcgattcagacggtgccgttgggtattgcg
gtcgcgctggaatttaccggtcctctggcggtcgcgctgttttcatcccggcggccggta
gattttatttgggtcgtactggctgtgcttgggctctggttcctgctgccattagggcaa
gatatgtctcacgtcgatcttaccggggccgcgttggcgctcggcgctggcgcctgttgg
gctgtctatattcttaccggccagcgagcaggcgcggaacatggtccggccacggtggcg
gtaggctcgctgattgccgccatcattttcgtgccgattggcgcagttcaggctggcgac
gcgctatggcactggtcgattcttcccttagggttagcggtcgctgtgctttctacggcg
ctgccttattcactggaaatgattgcactgacgcgcctgccaacccgcaccttcggtacg
ctgatgagcatggaacccgcgctgggcgaaacgcttacgggcatacaaatcctggccctg
tgcgccatcattgccgcctcaatgggttctaccctaacgattcgacgcgaaccgcaaatt
aaacaagttgacgtaaaatag

DBGET integrated database retrieval system