KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0939Help
Entry
SeD_A0939         CDS       T00757                                 

Definition
(GenBank) hypothetical protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
932086..932256
Genome map
AA seq 56 aa AA seqDB search
MLIEKSGQLPRLSLKCKRHFIFQHSLNHIQCAFMIIIIGSVTGDLFNVFCGIVHRK
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atgctcattgagaaatcggggcaattgccccgactctcgttaaagtgtaaacggcacttt
attttccagcacagcctgaatcacattcagtgcgccttcatgattattattatcggtagc
gtaacgggcgatttatttaatgttttctgcggcattgtccatcgcaaatga

DBGET integrated database retrieval system