KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0941Help
Entry
SeD_A0941         CDS       T00757                                 

Definition
(GenBank) putative cytoplasmic protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1479 COG5
Motif
Other DBs
NCBI-ProteinID: ACH74555
Structure
PDB: 

Jmol
Position
complement(933052..934317)
Genome map
AA seq 421 aa AA seqDB search
MTTPFTHETLPADPKAAIRQMKQALRAQIGDVQAVFDRLSATIAARVAEINDLKAQGQPV
WPIIPFSELAMGNISDATRAEVKRRGCAVIKGHFPREQALAWDQSMLDYLDKNHFDEVYK
GPGDNFFGTLSASRPEIYPVYWSQAQMQARQSEEMALAQSFLNRLWQVEHDGKRWFNPDI
SIIYPDRIRRRPPGTTSKGLGAHTDSGALERWLLPAYQRVFASVFNGNVEQYDPWNAAHR
TEVEEYTVDNTTKCSVFRTFQGWTALSDMLPGQGLLHVVPIPEAMAYILLRPLLDDVPED
ELCGVAPGRVLPISEQWHPLLMAALTSIPPLEAGDSVWWHCDVIHSVASVENQQGWGNVM
YIPAAPMCEKNLAYARKVKAALETGASPGDFPREDYETTWEGCFTLRDLNIHGKRALGMD
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgacgactccttttacccacgaaacgctgcccgccgacccaaaagcggccattcgtcag
atgaagcaggcgctacgcgcgcaaatcggcgacgtacaggcggtgttcgaccgtttgagc
gccaccatagcagcccgggtggcggaaattaacgatctgaaggcgcaggggcagccggta
tggccaattatcccttttagcgaactggcgatgggcaacattagcgatgccacccgcgcc
gaggttaagcgccgcgggtgcgcggtgattaaaggtcattttccacgcgaacaggcgctg
gcatgggaccagtcgatgctcgactatctggacaagaaccattttgacgaggtgtataaa
ggaccgggggataattttttcggtacgctgagcgcctcccggcctgaaatctatcctgtc
tactggtcgcaggcgcaaatgcaggcccgccaaagtgaagagatggcgctggcgcagtcg
ttcctcaaccgtctatggcaggtagagcacgacggcaagcgatggtttaatccggatatc
agcatcatttacccggatcgcatccgccgccgcccgccgggcaccacatccaaaggactg
ggggcgcataccgactccggtgcgctggagcgctggctgctgccagcctatcagcgggta
ttcgccagcgtgtttaacggcaacgtcgagcagtacgatccgtggaatgcggcacaccgt
accgaagttgaagagtatacggtggataacaccaccaaatgctcggtatttcgcaccttc
cagggctggaccgcgctctccgatatgctgcccggtcaggggttgcttcatgtcgtccct
atcccggaggcgatggcgtatattctgctgcgcccgctgctggatgatgtcccggaagat
gaattatgcggcgtcgcgccgggccgggtgctgccgatttctgaacagtggcatccttta
ctgatggcggcgttaaccagcattccgccgctggaagccggggattccgtgtggtggcat
tgcgatgtcatccactccgtcgcctccgtcgaaaatcagcagggctggggcaatgtgatg
tacattcctgccgcgccaatgtgtgagaaaaacctggcctatgcgcgtaaggtgaaagcg
gcgctggagacaggcgcatcaccgggcgatttcccgcgcgaggactatgaaaccacctgg
gaagggtgtttcacgctgcgcgatctgaatattcacggcaagcgggcattaggtatggac
gtttga

DBGET integrated database retrieval system