KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0943Help
Entry
SeD_A0943         CDS       T00757                                 

Definition
(GenBank) sugar phosphatase SupH
  KO
K07757  
sugar-phosphatase [EC:3.1.3.23]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Enzymes [BR:sed01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.23  sugar-phosphatase
     SeD_A0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
934579..935388
Genome map
AA seq 269 aa AA seqDB search
MTVNVVVTDMDGTFLDDAKQYDRVRFMAQYQELKKRNIEFVVASGNQYYQLISFFPELKD
EISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKDKQLNFVACGLKSAYVSKNAPE
TFVALMAKHYHRLQPVNDYHDIDDILFKFSLNLPDEQIPLVIDKLHVSLDGIMKPVTSGF
GFIDLIIPGLHKANGISRLLKRWNRSPQNVVAIGDSGNDAEMLKMAHYSFAMGNAADNIK
ALSRYHTDDNNHQGALNVIQAVLDGTDPF
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttaacgttgtcgttacagatatggacggcacttttctcgacgatgccaagcag
tacgatcgtgtacgcttcatggcgcaataccaggaactgaaaaaacgtaatatcgaattt
gtggtcgccagcggtaatcagtactaccagttgatctccttcttccccgagctgaaagac
gaaatttcctttgtcgcagaaaatggcgcgctggtgtatgaacatggcaagcagttgttt
cacggggagctaacccggcatgaatcgcggattgtgattggcgaactgctgaaggataag
cagcttaacttcgtcgcctgcggtctgaaaagcgcttatgtcagcaaaaacgctcccgag
actttcgtggcgctgatggccaaacattatcaccgcctgcagccggtaaacgattatcac
gacattgacgatatcctgtttaagttctccctgaatttgcccgatgaacaaattccgctg
gttatcgacaaactgcacgtatctctggatggcatcatgaagcccgtcaccagcggcttc
ggttttatcgacctgattatcccgggactgcataaagcgaatggcatcagtcgtctgtta
aagcgctggaacaggtcgccacagaatgtcgtcgccattggcgacagcggtaatgatgcg
gaaatgttgaaaatggcgcattactcttttgccatgggcaatgccgcagacaatatcaaa
gcgctttcacgttatcacactgatgataataaccatcaaggcgcgctcaacgtcattcag
gccgtgcttgacggcaccgatcccttctga

DBGET integrated database retrieval system