KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0944Help
Entry
SeD_A0944         CDS       T00757                                 

Definition
(GenBank) formate C-acetyltransferase 3
  KO
K00656  
formate C-acetyltransferase [EC:2.3.1.54]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SeD_A0944
   00640 Propanoate metabolism
    SeD_A0944
   00650 Butanoate metabolism
    SeD_A0944
Enzymes [BR:sed01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     SeD_A0944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(935466..937898)
Genome map
AA seq 810 aa AA seqDB search
MTQLKLDTLSDRIKAHKTALVHIVKPPVCTERAQHYTEMYQQHLDKPIPVRRALALAHHL
AERTIWIKHDELIVGNQASEVRAAPIFPEYTVSWIEKEIDDLADRPGAGFSVSEENKRIL
HDVCPWWRGQTVQDRCYGMFTDEQKGLLATGIIKAEGNMTSGDAHLAVNFPLLLEKGLDG
LRDKVAERRSRINLTVLEDLHGEQFLKAIDIVLDAVSQHITRFAALARQMAGEESRESRR
KELLTIAENCEVIAHQPPQTFWQALQLCYFIQLILQIESNGHSVSFGRMDQYLYPYYRRD
VELNQTLDREHAIELLHSCWLKLLEVNKIRSGSHSKASAGSPLYQNVTIGGQNLINGQPM
DAVNPLSYAILESCGRLRSTQPNLSVRYHAGMSNDFLDACVQVIRCGFGMPAFNNDEIVI
PEFIKLGIEPQDAYDYAAIGCIETAVGGKWGYRCTGMSFINFIRVMLAALEGGRDATSGK
VFLPQEKALSAGNFNNFDEVMAAWDTQIRYYTRKSIEIEYVVDTMLEENVHDILCSALVD
DCIERAKSIKQGGAKYDWVSGLQVGIANLGNSLAAVKKLVFEQGVIGQQQLAAALADDFD
GLTHEQLRQRLINGAPKYGNDDDSVDTLLARAYQTYIDELKQYHNPRYGRGPVGGNYYAG
TSSISANVPFGAATMATPDGRKAHTPLAEGASPASGTDHLGPTAVIGSVGKLPTGSILGG
VLLNQKLNPTTLENESDKQKLMVLLRTFFEVHKGWHIQYNIVSRETLLDAKKHPDQYRDL
VVRVAGYSAFFTALSPDAQDDIIARTEHML
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgacccaactgaaactggacacgctcagtgaccgcattaaggcgcacaaaaccgcgctg
gtacatatcgtgaaaccgccggtctgtaccgagcgcgcgcaacattataccgaaatgtat
cagcaacatctggataaaccgattccggtacgccgcgcgctggcgctggcccatcacctg
gcggaacgcactatctggataaaacacgatgaactgatcgtcggcaaccaggcaagtgaa
gtccgcgccgcgccgattttcccggaatataccgtctcgtggattgaaaaagagatcgac
gacctggcagaccggcccggcgcaggtttttccgtaagtgaagaaaacaaacgtattctg
cacgacgtctgtccgtggtggcgcggtcaaaccgtccaggatcgctgctacggcatgttt
accgatgaacaaaaagggcttctggcgactggcattatcaaagccgaaggcaatatgact
tccggcgatgcgcacctggcggtgaacttcccgctgctgctggaaaaagggcttgatggc
ctgcgcgataaagtcgccgagcgccgctcacgcatcaacctgaccgtgctggaagatctg
catggcgagcagttcctgaaggcgattgatattgtgctggacgcggtaagccagcacatc
acgcgctttgccgcgctggcgcgccagatggcgggcgaagagtcccgtgaaagccgtcgt
aaagagctacttaccatcgccgaaaactgcgaggtgatcgcccaccaaccgccgcagacc
ttctggcaagcactgcaattgtgctacttcatccaactgattctacaaattgagtctaac
ggtcactcggtgtcatttggtcgtatggaccagtatctttacccctattatcgtcgcgat
gtcgaactaaaccagacgctggatcgtgagcacgccattgaactgctgcacagctgctgg
ctgaaactgctggaagtaaacaagatccgctccggttcgcactctaaagcctccgcgggc
agcccgctgtatcaaaacgtcaccattggcggtcagaatctcatcaacggtcagccaatg
gacgcagtgaatccgctgtcttacgccattctggagtcctgtggacgtctgcgttctacc
cagcccaacctcagtgtgcgttatcacgccggaatgagtaacgatttccttgacgcctgc
gtccaggtcatccgctgcggctttgggatgccggcgtttaacaatgatgaaatcgtcatc
ccggaatttatcaagttggggatcgaaccacaggacgcttacgattacgcggcgatcggc
tgtatcgaaaccgccgtcggcgggaaatggggttatcgctgcaccggcatgagctttatt
aacttcatccgcgtcatgctggcggcgctggaaggcggtcgcgacgccaccagcggcaag
gtatttctgccgcaggaaaaggcgctctccgcaggcaactttaacaattttgacgaagtg
atggccgcctgggatacccaaattcgctactacacgcgcaaatcgatcgaaattgagtat
gtggtcgacaccatgttggaagagaacgtccacgatattctctgctcagcgctggtagac
gactgtattgaacgcgcgaagagtatcaagcaaggcggcgctaaatatgactgggtatcc
ggtcttcaggtcggtatcgccaacctgggcaacagcctcgccgccgtgaaaaaactggtc
ttcgaacagggcgttatcggtcaacagcagcttgccgccgcgctggccgatgactttgac
gggctgacccatgagcagctgcgccagcgtctgattaacggcgcgccgaagtacggtaac
gacgatgacagtgtcgataccctgctggcgcgcgcttatcagacctatattgatgagctg
aagcaataccataacccgcgctatggtcgtggccctgtgggcggcaactattacgccggt
acgtcctctatctcagcaaacgtgccatttggcgccgcgactatggctaccccggatggt
cgcaaagcgcatacgccgctggcggaaggcgcaagccctgcatcgggtacggatcatctc
ggcccgacggcggtgatcggttccgtaggcaaattacctaccggttccattctcggcggc
gtgctgctcaatcagaaactgaacccaacgacgctggaaaacgaatccgacaaacagaaa
ctgatggttctgctacggacgttctttgaggtgcataaaggctggcatattcagtacaac
atcgtgtcacgcgaaacgctgttggatgcgaaaaaacatccggaccagtaccgcgatctg
gtcgtgcgtgtggcaggctactccgccttcttcaccgcgctgtcgccggatgcgcaggac
gatatcatcgcccgtaccgaacatatgctgtaa

DBGET integrated database retrieval system