KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0951Help
Entry
SeD_A0951         CDS       T00757                                 

Gene name
gsiC
Definition
(GenBank) glutathione ABC transporter, permease protein
  KO
K13890  glutathione transport system permease protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed02010  ABC transporters
Module
sed_M00348  Glutathione transport system
Brite
KEGG Orthology (KO) [BR:sed00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SeD_A0951 (gsiC)
Transporters [BR:sed02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Glutathione transporter [MD:M00348] [OT]
    SeD_A0951 (gsiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF4064
Motif
Other DBs
NCBI-ProteinID: ACH74932
Position
945724..946644
Genome map
AA seq 306 aa AA seqDB search
MLNYVLKRLLGLIPTLLIVAVLVFLFVHLLPGDPARLIAGPEADAQVIALVRQQLGLDQP
LHVQFWHYITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAA
AVWRNRWPDRVGMTLAVTGISFPAFALGMLLMQIFSVDLGWLPTVGADSWQHYILPSLTL
GAAVASVMARFTRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMGLQFG
FLLGGSIVVEKVFNWPGLGRLLVDSVDMRDYPVIQAEVLLFSLEFILINLVVDVLYAAIN
PAIRYK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcttaactatgttctcaagcgcctgctgggattaattcctacgctgttgattgtggca
gtgctggtgtttttatttgttcatttgttgcccggcgacccggcgcggctgatagccgga
ccggaagccgacgcgcaggtgatcgcgctggttcgtcagcagctggggcttgatcagccg
cttcatgtccagttttggcattacatcacccatgttttacaaggcgatttcgggacgtca
atggtttcccgccgcccggtttctgaggagatcgccagccgctttttgccgacgctgtgg
ctgacgataaccagtatgatatgggcggtgctgtttggcatggcgatcggcatcgccgcc
gccgtgtggcgtaatcgctggcctgaccgggtaggaatgacgcttgccgtgaccggcatt
tctttcccggcttttgcgctgggaatgttgttaatgcagattttttccgtggatctgggc
tggctaccgaccgtgggggcggatagctggcaacattatattttaccctccctgacgctt
ggtgcggcggtggcatcagtcatggcgcgttttacgcgctcctcgtttgtcgatgtgctg
agcgaggattacatgaggaccgcgcgggcgaaaggcgtcagtgaaacgtgggtggtgtta
aaacatggcctgcgcaatgcaatgatcccggtcgtcaccatgatgggactgcaatttggc
tttctgcttggcggatcgatcgtcgtcgaaaaagtgtttaactggccggggcttgggcgg
ttactggtcgactccgtcgacatgcgcgactaccccgtgattcaggcggaagtgctgctg
ttttctctggaatttattcttatcaacttagtggtggatgtcctctatgccgccattaat
ccggctatcaggtataagtaa

DBGET integrated database retrieval system