KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0960Help
Entry
SeD_A0960         CDS       T00757                                 

Definition
(GenBank) acyl-CoA dehydrogenase domain protein
  KO
K00249  
acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SeD_A0960
  Lipid metabolism
   00071 Fatty acid degradation
    SeD_A0960
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SeD_A0960
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SeD_A0960
Enzymes [BR:sed01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     SeD_A0960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
952846..954009
Genome map
AA seq 387 aa AA seqDB search
MKSIEKDKYQDIRDAVSSLCSEFDDKYHRKIDEAKAYPEEFVNKLTKAGWLAALIPEEFG
GSGLGLTEASIIMEEINRSGGNSGACHGQMYNMNTLLRHGSDKQKEFWLPRIATGEWRLQ
SMGVTEPTAGTDTTRIKTTAIKREDRYVITGQKVWISRVQHSDWMILLVRTTPLANVKRK
SEGMSIFMVDIKEAMKNGMTVRPIPNMVNHETNELFFDNLEIPEENLIGEEGMGFHYILD
GLNAERTLIAAECIGDGYWFMDRVTRYTCEREVFGRPIGQNQGVQFPIAEAFIAVEAANL
MRFKACELFDQHLDCGAQANMAKYLAAKASWEAANACLQFHGGYGFACEYDIERKFRETR
LYQVAPISTNLILSYIAEHVLEMPRSF
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtattgaaaaggataaatatcaggatattcgtgatgcggttagttcattatgt
agtgaatttgatgataaatatcaccgtaagatagatgaagcaaaagcctatcctgaagag
tttgttaataaactaaccaaagctggttggctggctgcgctcatcccggaggaatttgga
gggtcagggcttggtttaactgaagcatctattatcatggaagagatcaatagatcgggt
ggaaactctggagcctgccatggtcagatgtataacatgaatacgttgttacgtcatgga
tccgataaacagaaagaattctggctgccacggatagctactggtgaatggcgcctgcag
tcgatgggcgtcacagaacccacagcaggtacagataccaccagaattaaaactacagct
ataaaaagagaagaccggtatgtgataaccggacaaaaagtctggatttcacgtgttcaa
cattcagactggatgattcttctggttcgaactactccgcttgcaaatgtaaaacgtaaa
tccgaagggatgtctattttcatggttgatattaaagaagctatgaaaaatggaatgaca
gtacgacctattcccaatatggtcaatcatgaaaccaacgagctcttttttgacaacctg
gaaattcccgaagaaaatcttattggtgaagagggtatgggttttcattacatacttgat
ggtttaaatgcagagcgtaccttgattgcggcagaatgtataggcgatggatattggttt
atggatcgtgttacccgctatacctgcgagcgtgaggtttttggtcgtcccattggtcag
aaccagggggtgcagtttcctattgcagaagcatttattgcagtggaagcggctaatctg
atgcgttttaaagcgtgcgagctttttgatcagcatcttgattgtggagcacaggctaat
atggcgaaataccttgctgcgaaagccagctgggaagcagccaatgcctgcctgcaattt
catggtggatatggttttgcctgtgagtatgatatcgaacgaaagtttagagaaacacgt
ttatatcaggttgctcccatatctaccaacctgatcctgagctatatcgctgagcatgtg
ctggagatgccacgttcattctga

DBGET integrated database retrieval system