KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0963Help
Entry
SeD_A0963         CDS       T00757                                 

Definition
(GenBank) citrate transporter family protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACH73891
Position
complement(957303..957728)
Genome map
AA seq 141 aa AA seqDB search
MYSLLMLVAYRGYSVILFAPLVALGAVLFTRPVTVAPVFSDIFMDKLIGFVKLYFPVFLL
GAVFGKLIEFAGFYYSIVSAVTCMVGQNKAMPMIILVCALLTYGGVSLFVVAFANLFFTW
LIPHIYGDQFMINLPGLKKPL
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgtattcattactgatgctggtcgcttatcgtggttacagtgtgatcctttttgctccg
ctggtagcacttggcgcagttctgttcacccgtccagtgacggtcgccccggttttcagt
gatatatttatggataagttgatcggttttgtaaaactttattttcctgtctttctgctg
ggtgcagtatttggcaagctgattgaatttgctggtttttactactcaattgtcagtgct
gtgacctgtatggtgggccagaacaaagccatgccgatgattattcttgtatgcgcttta
ttgacctatggaggcgtatcattgtttgtggtggcgtttgccaatctgttctttacttgg
ctgattccacatatttacggtgatcagtttatgataaatctgccggggctgaaaaaaccg
ctgtaa

DBGET integrated database retrieval system