KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0967Help
Entry
SeD_A0967         CDS       T00757                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase DacC
  KO
K07258  
serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SeD_A0967
Enzymes [BR:sed01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SeD_A0967
Peptidases [BR:sed01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   SeD_A0967
Peptidoglycan biosynthesis and degradation proteins [BR:sed01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SeD_A0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
959555..960835
Genome map
AA seq 426 aa AA seqDB search
MSALLLTALITRWCDVCFWNGYSGGTMTQYASSLRSLAAGSVLLFLFASPVKAEEQTIAP
PGVDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKAGKIKLTDMVTVG
KDAWATGNPALRGSSVMFLKPGDQVSVADLNKGIIIQSGNDACIALADYVAGSQESFIGL
MNAYAKRLGLTNTTFQTVHGLDAPGQFSTARDMALLGKALIHDVPDEYAIHKEKEFTFNN
IRQPNRNRLLWSTNLHVDGMKTGTTAGAGYNLVASATQGDMRLISVVLGAKTDRIRFNES
EKLLTWGFRFFETVTPIKPDATFVTQRVWFGDKREVNLGAGDAGSVTIPRGQLKNLKASF
TLNEPQLTAPLKKGQVVGTIDFQLNGKSIEQRPLMVMENVEEGGFFSRMWDFVLMKLHQW
FGSWFS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcgttattactcaccgcacttattacacggtggtgtgacgtgtgtttttggaat
ggatactcgggtggtactatgacgcaatacgcttcttcccttcgtagcctcgcggcaggt
tcggttctcttattccttttcgcttcgcctgtaaaggcagaggaacaaacgatcgcgccg
ccgggcgttgatgcgcgagcctggatcttaatggattacgccagcggtaaagtactggcg
gaaggcaacgccgatgagaaactcgaccctgccagtttgacaaaaattatgaccagctac
gtggtgggccaggcgctgaaggcagggaaaatcaagctgaccgatatggtgacggtgggc
aaagatgcctgggcgacggggaacccggcgctacgtgggtcgtcggtgatgtttctgaag
ccaggcgatcaggtgtcggttgcggatcttaataaaggcatcatcattcagtcaggtaac
gatgcctgtatcgcgcttgccgactacgtcgccggaagccaggagtcctttatcggcctg
atgaacgcctatgcgaaacgactggggttaaccaatacaaccttccagacggtacacggt
cttgatgcgccagggcagttcagtaccgctcgcgatatggcgttgctcggcaaggccttg
attcacgatgtgcctgacgaatacgccattcataaagaaaaagaatttacttttaataat
attcgtcaaccgaaccgcaaccgcctgttgtggagcaccaatctgcatgtcgacggcatg
aaaacggggacaacggctggcgctgggtataaccttgtcgcctccgccactcagggcgat
atgcgcctgatctctgtcgtgctgggggcgaaaacggaccgtattcgttttaatgagtca
gaaaaactgctgacctggggtttccgcttctttgaaacggtcacgccgattaaacctgac
gcgacattcgtgacgcaacgggtctggtttggcgataagcgtgaggtcaatttgggggcg
ggcgatgcggggtctgtgacgattccgcgtgggcagcttaaaaacctgaaggccagcttt
acgttgaacgaaccacagctcacggcgccgttgaagaaagggcaggttgtcggcaccatc
gatttccagcttaacggaaaatccattgagcaacgcccgttaatggtgatggaaaacgtc
gaggaggggggatttttcagccggatgtgggattttgtgctgatgaaactccatcagtgg
tttggcagttggttctcgtaa

DBGET integrated database retrieval system