KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A1353Help
Entry
SeD_A1353         CDS       T00757                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sed00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SeD_A1353 (ruvA)
Enzymes [BR:sed01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SeD_A1353 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1328683..1329294
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIILEKQPPIVLLETGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREELGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAVDLVLTSPASPTSEDAEQEAVAALVALGYKPQEASRM
VSKIARPDASSETLIRDALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcattattctcgaaaaacaacccccgatcgtgctgctggag
acagggggagtaggctatgaagtacatatgcctatgacctgcttttacgagctgccggag
gccgggcaggaggcaatcgtcttcacccacttcgtggtgcgtgaagatgcgcagttgctg
tacggatttaacaataagcaagagcgcacgctatttaaagagctaattaaaacgaatggc
gtcgggcctaagctggcgctggcgatcctctccggcatgtcggcgcaacagttcgtcaat
gcggttgagcgcgaagagcttggtgcgctggtgaagctgccgggtatcggcaagaaaact
gccgaacgattgattgttgaaatgaaagaccgctttaaagggctacatggcgatctcttc
acgcctgcggtcgatctggtattgacatcgccggccagcccaacctcggaagatgcagaa
caagaagcagttgctgcgctggtggcgctgggttataaaccgcaagaagccagccggatg
gtaagcaagatcgcccgtccggacgcaagcagtgaaacactgattcgcgacgcgttacgc
gccgcgctatga

DBGET integrated database retrieval system