KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A1402Help
Entry
SeD_A1402         CDS       T00757                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1371792..1372241
Genome map
AA seq 149 aa AA seqDB search
MRISEKGITLIKEFEGCSLTAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAER
LLNTGLVGYENDVSRLVKVKLTQGQFDALVSFAYNLGARTLSSSTLLRKLNAGDYAGAAD
EFLRWNKAGGKVLNGLTRRREAERALFLS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcagtgaaaaaggcattaccctaatcaaagagtttgaaggttgtagcctgaca
gcttatccggacccgggaacggggggagatccctggacgattggttatggctggacccac
tctgttgacggtaagccagttaagcccggaatgatgattgacgaggctactgccgagcgc
ttgcttaacactggtttagtcggttatgaaaatgatgtgtccagactggttaaggtcaag
ttgacgcaaggccagtttgatgcgctggtgtcgttcgcgtacaacctcggcgcccggaca
ttatcctcatcaactctgctgcggaagctaaacgctggtgattacgctggcgccgctgat
gagttcctgcgctggaataaggctggtggcaaagtactgaacgggcttacccgtcggcgt
gaggcggagcgtgctctgttcctgtcatga

DBGET integrated database retrieval system