KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A1543Help
Entry
SeD_A1543         CDS       T00757                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00900  Terpenoid backbone biosynthesis
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
sed01130  Biosynthesis of antibiotics
Module
sed_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SeD_A1543 (ispE)
Enzymes [BR:sed01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SeD_A1543 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACH73959
Position
complement(1491078..1491926)
Genome map
AA seq 282 aa AA seqDB search
MTHWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLHIEPRRDGEIHLLTPVTGVE
NEDNLIVRAARLLMKVASESGRLPAGSGADISIEKRLPMGGGLGGGSSNAATVLVALNHL
WQCGLSIDELATLGLTLGADVPVFVRGHAAFAEGVGEILTPVNPPEKWYLVAHPGVSIPT
PVIFKDPQLPRNTPKRSIDTLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGTG
ACVFAEFDTESCARQVLEQAPEWLNAFVAKGVNLSPLHRELL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacccattggccttctccggcaaaattaaatctgtttttatatatcaccggacagcgt
gcagacggctaccacacgctgcagacgctgtttcagtttctggattatggcgacacactc
cacatcgaaccgcgtcgcgatggcgaaatccatttattaacgccggtaaccggcgttgaa
aatgaagacaacctgatcgtccgcgccgcgcggctgttgatgaaagtcgcctcggagagt
ggacgcctgcccgccggaagcggcgcggatatcagcattgagaagcgccttcccatgggc
ggcggtctgggcggcggctcgtctaacgccgcgaccgttctggtggcgctcaatcatctt
tggcaatgcgggctttccattgatgaactggcgacgctcggcctgacgctcggcgccgac
gtcccggtctttgttcgtggccacgccgcgtttgccgaaggcgtaggcgaaatattaacg
ccggtgaatccgccggaaaaatggtatctggtcgcgcaccctggcgtaagcattccgacg
ccggttatctttaaagatcctcaattgccgcgtaatacgccaaaaaggtcaatagatacg
ttactaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgcgag
gttgatgcggcgctttcctggctgttagaatacgcgccgtcgcgcctgactgggacaggg
gcctgtgtctttgctgaattcgatacagagtcttgtgctcgccaggtgcttgagcaagcc
ccggaatggctcaatgcttttgtggcgaagggtgtcaacctttccccattgcatcgagag
ttactctaa

DBGET integrated database retrieval system