KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A1576Help
Entry
SeD_A1576         CDS       T00757                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00040  Pentose and glucuronate interconversions
sed00052  Galactose metabolism
sed00500  Starch and sucrose metabolism
sed00520  Amino sugar and nucleotide sugar metabolism
sed01100  Metabolic pathways
sed01130  Biosynthesis of antibiotics
Module
sed_M00362  Nucleotide sugar biosynthesis, prokaryotes
sed_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SeD_A1576 (galU)
   00052 Galactose metabolism
    SeD_A1576 (galU)
   00500 Starch and sucrose metabolism
    SeD_A1576 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SeD_A1576 (galU)
Enzymes [BR:sed01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SeD_A1576 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACH77708
Position
1519872..1520780
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGNEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGNSQIMVEPVEDVTAYGV
VDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWALLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNSLGAEFKAWLEEEMGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccttaattcgaaagtcaaaaaagccgttatcccggtcgcgggattgggaacc
aggatgctgccagcgaccaaagctatcccgaaagagatgctgccgctggttgataagcca
ttaattcagtacgtcgtgaacgaatgtatcgctgctggcattactgaaatcgtgcttgtt
acgcactcgtctaaaaactctattgaaaaccactttgataccagttttgagctggaagcg
atgctggaaaaacgcgttaagcgtcagcttctggaggaggttcagtctatttgccctccg
catgtcactattatgcaggtacgtcaagggctggcaaaaggcctgggccatgccgtattg
tgcgcgcatcccgttgtcggaaacgaacctgtcgctgttattctgccagacgttattctt
gacgaatatgagtccgacctgtctcaggataacctggctgaaatgatccgccgtttcgat
gaaaccggcaatagccagattatggttgagccagtagaagatgtgactgcatacggcgtg
gtcgattgtaaaggcgttgagctggcaccgggcgaaagtgtgccgatggttggcgtggtt
gaaaaaccaaaagcggatgtcgcgccgtctaaccttgcgattgtcgggcgttatgtgttg
agcgcggatatctgggcgttgctggcgaaaacccctccgggcgccggggatgaaattcag
ttgaccgatgctatcgatatgctgatcgaaaaagaaacggttgaagcctaccacatgaag
ggtaaaagccatgactgtggtaataagttaggatatatgcaggcattcgttgaatatggc
atccgtcataattcgctgggtgctgaatttaaagcctggcttgaagaagaaatgggtatt
aagaagtaa

DBGET integrated database retrieval system