KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A1601Help
Entry
SeD_A1601         CDS       T00757                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SeD_A1601 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SeD_A1601 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SeD_A1601 (trpA)
Enzymes [BR:sed01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SeD_A1601 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1543529..1544335)
Genome map
AA seq 268 aa AA seqDB search
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLAD
GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQ
VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRS
GVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKI
IEKNLASPEQMLAELRSFVSAMKAASRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaaaatttatttgcacagctcaacgatcgccgggaaggcgcttttgtc
cccttcgtgaccctgggcgaccctggcattgaacagtcactgaaaattatcgacacactg
attgacgctggcgccgacgctctggaactgggggttcccttctccgatccgctggccgat
ggccctaccatccagaatgcgaacttacgcgccttcgccgctggcgtcacgccggctcag
tgttttgaaatgctggcgctgattcgtgaaaaacacccgaccattccgattggcctgcta
atgtacgcgaatctggtgttcaataacggcatagatgcgttctatgcccgttgtgaacag
gttggcgtagattccgtgctggtcgcagatgtcccggttgaagagtcggcccccttccgc
caggcggcgttacggcataatatcgcgccgatcttcatctgcccgccaaatgcggatgac
gatcttctgcgccaggtcgcatcttacggccgcggttacacctacctgctttcgcgttcg
ggcgtcaccggcgcggaaaaccgtggcgcattgccgttgcatcatctcattgagaagctt
aaagagtaccatgccgcgcctgcgttacagggcttcggtatctcctcgccggaacaggtg
tctgcggccgtgcgtgccggggcggctggcgctatctccggctcagccattgtcaagatt
atcgagaaaaacctcgcgtctcccgaacagatgttggcggagctcaggtcctttgtctca
gccatgaaagccgccagccgcgcataa

DBGET integrated database retrieval system