KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A1601Help
Entry
SeD_A1601         CDS       T00757                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00260  Glycine, serine and threonine metabolism
sed00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
sed01130  Biosynthesis of antibiotics
sed01230  Biosynthesis of amino acids
Module
sed_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SeD_A1601 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SeD_A1601 (trpA)
Enzymes [BR:sed01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SeD_A1601 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NMO NanE
Motif
Other DBs
NCBI-ProteinID: ACH77330
UniProt: B5FU65
Structure
PDB: 

Jmol
Position
complement(1543529..1544335)
Genome map
AA seq 268 aa AA seqDB search
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLAD
GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQ
VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRS
GVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKI
IEKNLASPEQMLAELRSFVSAMKAASRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaaaatttatttgcacagctcaacgatcgccgggaaggcgcttttgtc
cccttcgtgaccctgggcgaccctggcattgaacagtcactgaaaattatcgacacactg
attgacgctggcgccgacgctctggaactgggggttcccttctccgatccgctggccgat
ggccctaccatccagaatgcgaacttacgcgccttcgccgctggcgtcacgccggctcag
tgttttgaaatgctggcgctgattcgtgaaaaacacccgaccattccgattggcctgcta
atgtacgcgaatctggtgttcaataacggcatagatgcgttctatgcccgttgtgaacag
gttggcgtagattccgtgctggtcgcagatgtcccggttgaagagtcggcccccttccgc
caggcggcgttacggcataatatcgcgccgatcttcatctgcccgccaaatgcggatgac
gatcttctgcgccaggtcgcatcttacggccgcggttacacctacctgctttcgcgttcg
ggcgtcaccggcgcggaaaaccgtggcgcattgccgttgcatcatctcattgagaagctt
aaagagtaccatgccgcgcctgcgttacagggcttcggtatctcctcgccggaacaggtg
tctgcggccgtgcgtgccggggcggctggcgctatctccggctcagccattgtcaagatt
atcgagaaaaacctcgcgtctcccgaacagatgttggcggagctcaggtcctttgtctca
gccatgaaagccgccagccgcgcataa

DBGET integrated database retrieval system