KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A1603Help
Entry
SeD_A1603         CDS       T00757                                 

Definition
(GenBank) tryptophan biosynthesis protein trpCF (EC:4.1.1.48 5.3.1.24)
  KO
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SeD_A1603
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SeD_A1603
Enzymes [BR:sed01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SeD_A1603
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SeD_A1603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1545538..1546896)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIANIYQHYASAISVLTDEKYFQGSFDFLPVVSQSAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLSAVAHSLKMGVLTEVSNDEERERAIALGAKV
VGINNRDLRDLSIDLNRTRQLAPKLGHGVTVISESGINTYGQVRELSHFANGFLIGSALM
AHDDLNAAVRRVLLGENKVCGLTRAQDAKAACDAGAIYGGLIFVPSSPRAVSVEQAREVI
SGAPLQYVGVFQNADIADVCQKAAVLSLSAVQLHGSEDQAYVNALREALPRNVQIWKALS
VSNALPARDYHHVDKYIFDNGQGGSGQRFDWSLLQGQPLDDVLLAGGLAADNCVQAAQVG
CAGLDFNSGVESQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaagcccgcaaa
cagcaacagccgctggccagctttcaaaatgagatccagccaagtacacgccatttttat
gatgcgctccagggcgcgcgtaccgcctttattctggagtgtaagaaagcatcgccatca
aaaggcgtgattcgcgatgatttcgatccggcgcgtattgccaatatttatcaacattac
gcctcggcaatctcggtgctcaccgacgaaaaatattttcagggtagcttcgattttctg
ccggtcgttagccaaagcgcaccgcagccgattctgtgtaaggattttattatcgatccc
tatcagatctaccttgcccgttactatcaggccgatgcctgtttactgatgctctcggtt
ctggatgacgaacagtatcgccaactctccgccgtcgcgcacagtctgaaaatgggcgtg
ctcacggaagtcagtaatgacgaagaacgggagcgcgcgatagcgttaggcgcaaaagtg
gtaggtatcaacaatcgcgatctgcgcgatctgtcgattgatttgaatcgcacccgccag
ctggcgccaaaactgggccacggcgtgactgtcatcagcgagtccgggattaacacctat
ggtcaggtacgcgaactgagccacttcgccaacggttttttaattggctcggcgttaatg
gcgcatgacgatcttaacgccgccgtccgtcgcgtgctgcttggcgaaaataaagtctgc
ggcctgacccgcgcccaggacgctaaagcggcctgtgacgctggcgcaatatatggcggg
ttgatttttgtgccctcatctccacgcgcggtgagcgttgagcaggcgcgagaagtgata
agcggcgcgccattgcagtatgtcggcgttttccagaacgctgatatcgccgatgtttgc
cagaaagccgccgtcctgtcgctttctgccgtacagctacatggcagcgaagaccaggcg
tatgtcaacgcgctgcgcgaggcgttgccgcgcaatgtgcaaatctggaaggcgctgagc
gttagcaatgcccttcccgcacgcgattatcaccatgtcgataaatacattttcgacaat
gggcaaggcggcagcgggcagcgcttcgactggtcactgctacaggggcaaccgctggat
gatgtgttactggcgggcgggctggcggccgataactgcgtccaggcggcgcaagtcggc
tgtgccggtctcgattttaattcaggtgtggagtcacagccgggcatcaaagatgctcgt
cttctggcctcggtttttcagacactgcgcgcatattaa

DBGET integrated database retrieval system