KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A1776Help
Entry
SeD_A1776         CDS       T00757                                 

Definition
(GenBank) alcohol dehydrogenase, propanol-preferring
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00010  Glycolysis / Gluconeogenesis
sed00071  Fatty acid degradation
sed00350  Tyrosine metabolism
sed00625  Chloroalkane and chloroalkene degradation
sed00626  Naphthalene degradation
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
sed01120  Microbial metabolism in diverse environments
sed01130  Biosynthesis of antibiotics
sed01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeD_A1776
  Lipid metabolism
   00071 Fatty acid degradation
    SeD_A1776
  Amino acid metabolism
   00350 Tyrosine metabolism
    SeD_A1776
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SeD_A1776
   00626 Naphthalene degradation
    SeD_A1776
Enzymes [BR:sed01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SeD_A1776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C SCP2
Motif
Other DBs
NCBI-ProteinID: ACH77951
Position
complement(1719725..1720735)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHQVDVTEKTLRPLRHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNTGNETLCRNVKNAGYTVDGGMAEE
CIVVADYAVKVPEGLDSAAASSITCAGVTTYKAVKISHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLKLAEEMGADLTINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMNLDIPRLVLDGIQVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLEDINVIFKEMEQGQIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttgtcacacaagatcatcaggttgatgttactgagaaaacgctgcgt
ccccttcgccacggtgaagctttgctaaaaatggagtgctgcggcgtatgccataccgat
ctacacgtgaaaaacggcgatttcggtgacaaaaccggcgtcattctgggacacgaaggc
attggcgtcgtggcggaagtcggtcctggtgtcacctcgctgaaacccggcgatcgcgcg
agtgtcgcgtggttttatgaaggatgcggacactgtgagtattgcaatacgggcaatgaa
accttatgccgcaacgtgaaaaatgccggttacacggtagatggcggcatggccgaagag
tgtattgtcgtcgcggattatgcggtgaaagtaccggaaggtctggactctgcggcggca
agtagtattacctgcgcgggcgttaccacgtataaagcggtgaagatttctcatattaaa
cctggccagtggattgccatctacggtctgggcggtctgggtaatctggccttgcagtac
gcgaaaaacgttttcaatgcgaaagtgatcgccattgatgtcaatgatggacaactgaaa
ctggccgaggaaatgggcgcagatctgaccattaattcacgtacggaagatgcggctaaa
attgtgcaggaaaaaaccggtggcgcgcacgcagcggtggttaccgcggtcgctaaggcg
gcgtttaattccgcagtagatgccgttcgcgccggaggtcgcgtggtggcagtcgggctg
ccgccagaagccatgaaccttgatatccctcgcctggtgctggatggcattcaggttgtc
ggttcgttggtggggacacgccaggatctgaccgaagccttccagttcgcggcggaagga
aaagtcgtgccaaaagtcgctttacgtccgcttgaagatatcaacgttatttttaaagag
atggaacaagggcaaattcgtggccgtatggtcatcgatttccgtcgttaa

DBGET integrated database retrieval system