KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A2018Help
Entry
SeD_A2018         CDS       T00757                                 

Gene name
pfkB
Definition
6-phosphofructokinase (EC:2.7.1.56)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SeD_A2018 (pfkB)
   01230 Biosynthesis of amino acids
    SeD_A2018 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeD_A2018 (pfkB)
   00030 Pentose phosphate pathway
    SeD_A2018 (pfkB)
   00051 Fructose and mannose metabolism
    SeD_A2018 (pfkB)
   00052 Galactose metabolism
    SeD_A2018 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    SeD_A2018 (pfkB)
Enzymes [BR:sed01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SeD_A2018 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1951604..1952536
Genome map
AA seq 310 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIAHLGGTATAIFP
AGGATGEHLVALLADENVPVSTVDAKDWTRQNLHVHVESSGEQYRFVMPGATLDDDEFRQ
LEEQVLEIESGAILVISGSLPPGVKVEKLTQLISAAQKQGIRCIIDSSGDALTAALALGD
IELVKPNLKELSALVNRDLTQPDDVRKAAQELVQSGKARRVVVSLGPQGALGIDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAQDASLEEMVRFGVAAGSAATLNQGTRLCSRDDT
QKIYAYLSAQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacgcttgcgccctctctcgatagcgcaacaatcacgccg
caaatttatcccgaaggtaaactgcggtgctccgcgccggtattcgaacccggcggcggg
ggtattaatgtcgctcgcgccattgcgcatcttggcggcaccgcgaccgcaattttcccg
gctggcggcgctaccggcgaacatctggtcgcactactggctgacgaaaatgtccccgtg
tctaccgtcgatgcgaaagactggacgcgtcagaacctgcacgtccacgtcgagtccagc
ggcgaacagtatcgttttgttatgcccggcgccacgctggacgatgacgaatttcgccag
cttgaagaacaggtactggaaattgaatccggggcaattctggttatcagcggcagcctt
ccgcccggcgttaaggtcgagaaactcacgcaactgatttccgccgcacagaagcaaggc
attcgctgcattattgatagctctggcgacgcgctcaccgccgcgctggcgcttggcgat
atcgaactggtgaaacctaacctgaaagaattgagcgcgttggttaatcgcgatctgacg
cagcctgatgatgtgcgtaaagcggcccaggaattagtgcaaagcggcaaggctcgccgg
gtagtggtctctctggggccgcaaggggcgctgggcatagacagtgagaattgcatccag
gttgttcctcccccggtgaaaagtcaaagtactgtcggcgcaggcgacagtatggtgggc
gcgatgacgttaaaactggcgcaagacgcgtcgctggaagagatggtgcgctttggtgtg
gcggcaggcagcgccgctacgctcaatcaaggtacgcgtctgtgttcccgtgacgatacc
caaaaaatatacgcctatctttccgcgcaataa

DBGET integrated database retrieval system