KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A2434Help
Entry
SeD_A2434         CDS       T00757                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:sed00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sed00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2306771..2307319)
Genome map
AA seq 182 aa AA seqDB search
MIVIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKSKKNVLRG
LHFQRGENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHG
FVTLSEYAEFLYKATNYYSPSSEGSILWNDETIGIEWPFSQLPELSAKDAAAPLLHQALL
TE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgattaaaacagcaataccagatgtcttgatcttagagcctaaagtttttggc
gatgagaggggattcttttttgaaagttataaccagcagacctttgaagagttgattgga
cgtaaagttacatttgttcaagataatcattcaaaatccaaaaagaacgtactcagaggg
ctacattttcagagaggagaaaatgcacaggggaagttagttcgttgtgctgtcggtgag
gtttttgatgttgcggtcgatatccgaaaagaatcgcctacttttggtcaatgggttggc
gtaaatctatctgctgagaataagcgacagctttggattccagaaggttttgctcatggt
tttgttactcttagtgagtatgcagagtttctgtacaaagcaactaattattactcacct
tcatcggaaggtagcattttatggaatgatgagacaataggtattgaatggcctttttct
cagctgcctgagctttcagcaaaagatgctgcagcacctttactgcatcaagccttgtta
acagagtaa

DBGET integrated database retrieval system