KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A2765Help
Entry
SeD_A2765         CDS       T00757                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00010  Glycolysis / Gluconeogenesis
sed00052  Galactose metabolism
sed00500  Starch and sucrose metabolism
sed00520  Amino sugar and nucleotide sugar metabolism
sed00521  Streptomycin biosynthesis
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
sed01120  Microbial metabolism in diverse environments
sed01130  Biosynthesis of antibiotics
sed01200  Carbon metabolism
Module
sed_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sed_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeD_A2765 (glk)
   00052 Galactose metabolism
    SeD_A2765 (glk)
   00500 Starch and sucrose metabolism
    SeD_A2765 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SeD_A2765 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SeD_A2765 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SeD_A2765 (glk)
Enzymes [BR:sed01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SeD_A2765 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: ACH75801
UniProt: B5FQA0
Position
complement(2644105..2645070)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVVRVYLDEHSVSVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDFAPNSEEEAMILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITERALADSCIDCRRALSLFCVI
MGRFGGDLALTMGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKDYVHGIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttagtaggagatgtaggcggcacgaatgcgcgtcttgccctgtgt
gatatcgccagtggagaaatctcgcaggccaaaacgtattccggcctggattatcccagt
cttgaggccgtggtgcgcgtttatctcgatgagcatagcgtcagcgtggaagatggttgt
atcgccatagcctgcccgattaccggtgactgggtagcgatgactaaccatacctgggct
ttttctattgcggaaatgaaaaaaaatctcggctttagccatctggaaatcatcaacgat
ttcaccgccgtgtcgatggcgatcccgatgctgaaaaaagagcatttaattcagttcggc
ggcggcgaaccggtagacggcaaacctattgcggtgtatggcgcgggaaccggcttgggc
gtggcgcatctggtgcatgtggataagcgttggattagccttccgggcgaaggcgggcat
gtcgattttgcgcctaatagcgaagaagaagctatgattctggaaatattgcgcgccgaa
attggccacgtttccgccgagcgcgtgctgtctggcccggggctggtgaatctttaccgg
gcgattgttaagtccgacaaccgtctgccggaaaatctgcgcccgaaagatattaccgaa
cgcgccctggcggatagctgtatcgattgtcgccgcgcgttgtcgctcttttgcgtcatc
atggggcgatttggcggcgatctggcgttaaccatggggacatttggcggcgtttatatc
gctggcggtattgtcccgcgcttcctggaattttttaaagcgtccggcttccgtggtggc
tttgaagataaaggccgctttaaagattatgtacacggtattccggtctatctgattgtc
catgataaccctggcttgttaggctccggcgcgcatctgcgccagacattaggccatatt
ctataa

DBGET integrated database retrieval system