KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A3993Help
Entry
SeD_A3993         CDS       T00757                                 

Gene name
bcsZ
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SeD_A3993 (bcsZ)
Enzymes [BR:sed01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SeD_A3993 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3837193..3838302)
Genome map
AA seq 369 aa AA seqDB search
MMTMLRGWITMIVMLTAINAQAACSWPAWEQFKKDYISQQGRVIDPGDARKITTSEGQSY
AMFFALAANDRPAFAQLFNWTQNNLAQGSLREHLPAWLWGQKDPDTWSVLDSNSASDGDI
WMAWSLLEAGRLWKETRYTEVGTALLKRIAREEVVNVPGLGSMLLPGKIGFAEANSWRFN
PSYLPPQLAQYFSRFGAPWSTLRETNLRLLLETAPKGFSPDWVRYESKQGWQLKAEKTLI
SSYDAIRVYLWTGMMHDGDPQKARLLARFKPMATLTMKNGVPPEKVDVVSGNAQGTGPVG
FSAALLPFLQNRDAQAVQRQRVADHFPGSDAYYNYVLTLFGQGWDQHRFRFTVKGELLPD
WGQECVSSR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgactatgctgcgcggatggataacgatgatcgtcatgctgacggcaataaatgcg
caggcggcctgtagctggcctgcgtgggaacagttcaagaaagattacattagccagcag
ggacgcgttatcgatccgggcgatgcgcgaaaaattaccacctccgaagggcaaagctac
gccatgttctttgccctggcggcgaacgatcgaccggcgttcgcgcaactgtttaactgg
acgcaaaacaatctggcgcagggatcgctgcgtgaacatctgcccgcctggctgtgggga
caaaaagatcccgacacctggtcggtgctggacagcaactccgcgtccgacggcgatatc
tggatggcatggtcgctgctggaggccggtcgcctgtggaaagagacgcgttataccgag
gtgggcacggcgttgctaaaacgcatcgcccgcgaagaggtcgtgaatgtgccggggctg
ggctcaatgctgctacctggcaaaatcggctttgccgaggcgaatagctggcgttttaac
ccaagctatctgccgccgcagttggcgcaatactttagccgttttggcgcgccgtggtcg
acgctacgggaaaccaatttgcggcttttgctggaaaccgcgccgaaaggtttctcgccg
gactgggtgcgttatgaaagcaagcaaggctggcagttgaaagcggaaaagacgctgatc
agtagctacgatgcgattcgcgtctatttatggacgggaatgatgcatgatggcgatccg
caaaaagcgcgtttactggcgcgatttaaaccgatggcgacgttaacgatgaaaaacggc
gttccaccggagaaagtggatgtcgtcagcgggaatgcgcaggggacggggccggtcggg
ttttccgccgctttactgcctttcctgcaaaatcgcgacgcccaggccgtgcagcgacag
cgggtcgcagaccattttcctggcagcgatgcctattacaactatgtgctgactctcttt
ggacaaggctgggatcagcaccgttttcgcttcaccgtcaaaggtgaattattacctgac
tggggccaggaatgcgtaagttcacgttaa

DBGET integrated database retrieval system