KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A4044Help
Entry
SeD_A4044         CDS       T00757                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SeD_A4044 (xylA)
   00051 Fructose and mannose metabolism
    SeD_A4044 (xylA)
Enzymes [BR:sed01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SeD_A4044 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3886715..3888037)
Genome map
AA seq 440 aa AA seqDB search
MQAYFDQLDRVRYEGPQSTNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMF
GVGAFNRPWQQPGEALELAKRKADVAFEFFHKLNVPFYCFHDVDVSPEGASLKEYKNNFA
QMVDVLAAKQEQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMNATHKL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKMGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIATAIALGIFGSVDANRG
DAQLGWDTDQFPISVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALSLKIAARMVEDGELDKRVAKRYAGWNSELGQQILKGQLSLGELAQYAEQHNLAPV
HQSGHQELLENLVNRYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcttattttgaccaactcgatcgtgttcgctatgaaggccctcaatcgactaac
ccgctggcatttcgtcattacaatcccgacgagctggttttaggtaaacgtatggaagat
cacctgcgtttcgcggcctgttactggcataccttctgctggaacggcgcggatatgttt
ggtgtaggcgcgtttaatcgtccgtggcagcaaccgggcgaagcgctggagctggcgaaa
cgcaaagcggacgtggcgtttgaatttttccacaaactgaatgtgcctttttattgcttc
catgacgtggatgtgtcgccggaaggcgcgtcgttgaaagaatataaaaacaacttcgcg
cagatggtggatgtgctggcggcgaaacaggagcagagcggcgtaaaactgctgtgggga
acggcgaactgctttaccaacccgcgctatggcgcaggcgccgccactaacccggacccg
gaagtctttagctgggcagcgacgcaagtggttacggcaatgaacgccacgcataaactg
ggcggcgaaaattacgtcctgtggggcgggcgcgaaggttatgaaacgttgctgaatacc
gatctgcgccaggaacgcgaacagattggccgctttatgcaaatggtggtcgagcacaaa
cataaaatgggcttccagggcacgctgctgattgaaccgaaaccgcaggaaccgacaaaa
catcagtatgattatgacgttgcaacggtctatggcttcctcaaacagttcggcctggaa
aaagagatcaaagtgaacattgaggcgaaccacgcgacgctggcgggccattcgttccac
catgaaatcgcgaccgctatcgcgctgggtatttttggctccgttgacgccaaccgcggc
gatgcgcaactgggctgggataccgatcagttcccgattagcgttgaagagaacgcgctg
gtgatgtacgaaatcctgaaagcgggcggattcacgacgggcggtctcaacttcgacgcc
aaagttcgtcgccagagcaccgataaatacgatctgttctacggtcatatcggcgcgatg
gatacgatggcgttgtcgctgaaaatcgccgcgcgtatggttgaagacggcgagctggat
aaacgcgtggcgaagcgctatgccggctggaatagcgagctgggtcagcagattctgaaa
ggacaactctccttaggcgaactggcgcagtatgcggagcagcataatctggcgccagta
catcaaagcggtcatcaggagctgttagaaaatctggttaaccgttatctgtttgataaa
taa

DBGET integrated database retrieval system