KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A4344Help
Entry
SeD_A4344         CDS       T00757                                 

Definition
phospholipase A (EC:3.1.1.32 3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SeD_A4344
   00565 Ether lipid metabolism
    SeD_A4344
   00590 Arachidonic acid metabolism
    SeD_A4344
   00591 Linoleic acid metabolism
    SeD_A4344
   00592 alpha-Linolenic acid metabolism
    SeD_A4344
Enzymes [BR:sed01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     SeD_A4344
    3.1.1.32  phospholipase A1
     SeD_A4344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4188680..4189549
Genome map
AA seq 289 aa AA seqDB search
MRAILRGLLPATLLPLAAYAQEATIKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTNTSDLNKEAISTYNWSENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSKESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVIGSTDDNPDITKYMGYYQLKIGYHLGEAVLSAKGQYNWNTGY
GGAEVGLSYPVTKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDIF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgattttgagagggttgttgccagccacgctactgccattagcggcatatgca
caagaagctacgataaaagaggttcatgatgcgcctgcagtacggggaagtatcatcgct
aacatgctacaggagcatgataacccttttacgctttacccttatgacacgaactacttg
atctacacgaacaccagcgatctgaacaaagaggccataagtacctacaactggtctgaa
aacgcacgtaaagatgaagtgaaatttcagttgagcctggcgtttccgctgtggcgcgga
atactggggccgaactcggtactgggcgcttcctatacgcagaaatcctggtggcagctt
tccaacagtaaagagtcttcgccgtttcgcgaaaccaactacgaaccgcagctttttctt
ggttttgctaccgattatcgctttgccggctggacgctgcgcgacgtagagatgggctac
aaccatgactctaacggacgttcggaccccacctcgcgtagctggaaccgtctgtatacc
cgtctgatggccgaaaacggtaactggctggtagaggtcaaaccgtggtacgtgattggc
agtaccgacgataatccggacatcaccaaatatatgggttattaccagcttaaaatcggt
tatcacctgggcgaggcggtattaagcgccaaaggccagtacaactggaatacaggctac
ggcggcgcggaagttggattaagctatccggtcaccaaacatgtccggctttatacccag
gtgtacagcggctatggcgaatcgctgatcgactataattttaatcagacacgtgtcggc
gtcggcgtgatgcttaacgatatcttctga

DBGET integrated database retrieval system