KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A4369Help
Entry
SeD_A4369         CDS       T00757                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SeD_A4369 (fadB)
   01212 Fatty acid metabolism
    SeD_A4369 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SeD_A4369 (fadB)
   00650 Butanoate metabolism
    SeD_A4369 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SeD_A4369 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SeD_A4369 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SeD_A4369 (fadB)
   00310 Lysine degradation
    SeD_A4369 (fadB)
   00380 Tryptophan metabolism
    SeD_A4369 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SeD_A4369 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SeD_A4369 (fadB)
   00281 Geraniol degradation
    SeD_A4369 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SeD_A4369 (fadB)
Enzymes [BR:sed01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SeD_A4369 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SeD_A4369 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SeD_A4369 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     SeD_A4369 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4216308..4218623)
Genome map
AA seq 771 aa AA seqDB search
MISAERDHIGISLIIYLHFINTKYTLRFIWYDQITLWIQETDMLYKGDTLYLDWLEDGIA
ELVFDAPGSVNKLDTATVASLGQALEVLEKQHDLKGLLLRSNKAAFIVGADITEFLSLFL
VPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLP
ETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAI
AVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGMVAQTAGKHYPAPMTAVKTI
EAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVKGKAKKLTKDIETPKQAAV
LGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAAKLLNKQLERGKIDGLKLAGVI
STIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRPETVLASNTSTIPIGELAS
ALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAWASKMGKTPIVVNDCPGFF
VNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAA
GFPQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSKGKPKKEEDAAVDDLLASVSQT
KRDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVYGLGFPPFHGGAFRWLDTQ
GSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPARPVGSLKTA
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
gtgatctctgccgagcgtgatcacatcggcatttctttaatcatttatttgcattttatt
aacacaaaatacacacttcgcttcatctggtacgaccagatcaccttgtggattcaggag
actgacatgctttataaaggcgacaccctgtacctcgactggctggaagatggcatcgcc
gaactggtgttcgatgctccaggctcggtcaataaactcgacaccgcaaccgtcgccagc
ctcggccaggcgcttgaggtgctggaaaagcaacacgatttaaaagggctgctgctgcgc
tctaataaagcggcctttattgtcggcgcggacatcaccgaatttctttcactgttcctc
gtccccgaagagcagttaagccaatggctgcatttcgctaatagcgtctttaaccgtctg
gaagatttacccgtaccgacccttgccgccgtaaacggctatgcgttgggcggcgggtgc
gaatgcgtgctggccaccgattaccgtctggcgacgccagacctccgtatcggtctgccg
gaaactaaactgggcatcatgccgggtttcggcggctccgttcgtctgccgcgtatgctg
ggcgcagacagcgcgctggagattatcgcggcaggtaaagatgtcggtgctgagcacgcg
ctgaaaatcggccttgtggacggcgtggtcaaacaagagaagctaattgaaggcgcgata
gcggtgttacgccaggccattaccggcgatctcgactggagagctaaacgccagccgaaa
ctggaaccgttgaaactcagtaagattgaagcggcgatgagctttaccatcgctaaaggc
atggtcgcacaaacggcgggtaaacattatccggcgccgatgaccgcagtgaaaaccatt
gaagccgccgcgcgttttggtcgtgaagaagcgctgaatctggaaaataaaagctttgtt
ccgctggcgcataccaatgaggctcgtgcgctggtcggtatcttcctcaacgatcaatat
gtaaaaggtaaagccaaaaagctgaccaaagatattgagacgccgaaacaggcagccgta
ctgggcgcgggcattatgggcggcggtatcgcttaccagtcggcctggaaaggcgtaccg
gtcatcatgaaagatatcaacgataaatcgttgaacctcggcatgaccgaagcggccaag
ctgctgaacaaacagctggagcgcggcaagatcgacggtctgaagctggcgggcgtcatt
tcgaccatccacccgactctcgattatgccggtttcgatcgcgtagatgttgttgtcgaa
gcggtagtcgaaaatccgaaagtgaaaaaagcggtactggcggaaaccgagcagaaagtg
cgcccggaaaccgtgctggcctcaaatacctccaccatcccaattggcgaactggcaagc
gccctggaacgtccggaaaacttttgcggaatgcacttcttcaacccggtacaccggatg
ccgctggttgaaatcattcgcggcgagaagagttcagacgaaaccatcgccaaagtcgtc
gcctgggccagcaaaatgggcaagacgccgattgtagtcaacgactgccccggcttcttt
gttaaccgcgtgctgttcccctatttcgccggtttcagtcaactgctgcgcgacggcgcg
gatttccgcaaagtcgataaagtgatggaaaaacagttcggctggccgatgggcccggcc
tatctgctcgacgtggtgggtattgataccgcccaccacgcgcaggcggtaatggcggca
ggcttcccacaacggatgcagaaagagtatcgcgacgcgatcgacgcattgtttgacgcc
agccgttttgggcaaaaaaacggtctgggcttctggcgctataaagaagacagcaagggt
aagccgaagaaagaagaagatgctgcggtggatgacctgctggcaagcgtcagtcagacg
aaacgcgacttcagcgacgacgagataatcgcccgtatgatgatcccgatgattaacgaa
gtggttcgctgtctggaagaaggcattatcgcaagcccggcggaagccgatatggcgctg
gtctacggcctgggcttccctccgttccacggcggcgcattccgctggctggatacacag
ggcagcgcgaaatatcttgatatggcgcagcagtatcaacacctcggcccgctgtatgaa
gtgccggaagggctgcgtaataaagcgcgccataacgaaccgtattatcccccggttgaa
ccagcccgtccggttggttctctgaaaacggcttaa

DBGET integrated database retrieval system