KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A4485Help
Entry
SeD_A4485         CDS       T00757                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SeD_A4485 (glpK)
Enzymes [BR:sed01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SeD_A4485 (glpK)
Exosome [BR:sed04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SeD_A4485 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4321300..4322808)
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKPGWVEHDPMEIWASQSST
LVEVLAKADISSDQIAAIGITNQRETAIVWERETGKPIYNAIVWQCRRTADICEQLKRDG
LEDYIRDNTGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHDLDWDDKMLDVLDIPRAMLPQVRKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPSGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDELQEKAVIEREFRPGIETTER
NYRYSGWKKAVKRAMAWEEHDK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaaaatatatcgttgcgctcgaccagggtaccaccagctcccgcgcggtc
gttatggatcatgacgcgaatatcgtcagcgtatcacagcgtgaatttgagcaaatttat
cctaagccaggctgggtagaacacgacccgatggaaatttgggcgtcccaaagctcaacg
ctggtagaagtgctggctaaggccgatatcagttccgatcagattgccgctatcggtatc
accaaccaacgtgaaaccgcgatcgtctgggaacgtgaaaccggcaaaccgatatacaac
gctattgtctggcagtgccgtcgtaccgccgatatttgcgaacagcttaaacgcgacggc
ctggaagattacatccgcgacaataccggtctggtcgtcgacccgtacttctctggcact
aaagtgaaatggatccttgaccatgtggaaggttcgcgcgaacgcgcgaagcgtggcgag
ctgctgttcggtacggtggatacctggcttatctggaagatgacgcagggccgcgtccac
gttacggattacaccaacgcctcacgaaccatgctgttcaacatccatgatttggactgg
gacgataagatgctggacgtgctggatatcccacgcgcgatgctgccccaggtacgtaag
tcctccgaagtctacggccagaccaatattggcggtaaaggcggtacacgtattcctatc
gccgggattgccggggatcagcaggccgcgctattcggccaactgtgcgtaaaggaagga
atggcaaagaatacctacggcaccggctgctttatgctgatgaacaccggcgagaaagcg
gtaaaatcggaaaacggcctgctgaccaccatcgcctgcggcccaagcggcgaagtcaac
tatgcgctggaaggcgcggtgtttatggcgggagcgtccattcaatggctgcgtgatgaa
atgaagctcatcagcgacgcgttcgactccgaatatttcgccacgaaagtgaaagatacc
aacggtgtctacgtggttccggccttcaccggtctgggcgcgccgtactgggacccgtat
gcccgcggcgccatttttggcctgacccgcggcgtgaactctaatcacattatccgcgcg
acgctcgaatccatcgcttaccagacccgcgacgtactggaagcgatgcaggccgactcc
ggtatccgcctgcacgctctgcgtgtggacggcggcgcagtggccaacaacttcctgatg
cagttccagtcagatattctcggcacgcgggtggaacgcccggaagtgcgcgaagtgacc
gcgctgggcgccgcctatctggctggcctggccgtcggttactggcagaacctggacgag
ctgcaggaaaaagccgtcattgagcgagaattccgccccggcattgaaaccaccgagcgt
aactaccgttacagcggctggaagaaagcggttaaacgcgcaatggcgtgggaagagcac
gacaagtaa

DBGET integrated database retrieval system