KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A4693Help
Entry
SeD_A4693         CDS       T00757                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SeD_A4693
  Lipid metabolism
   00561 Glycerolipid metabolism
    SeD_A4693
   00600 Sphingolipid metabolism
    SeD_A4693
Enzymes [BR:sed01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SeD_A4693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4557146..4558501
Genome map
AA seq 451 aa AA seqDB search
MMTAPKITFIGAGSTIFVKNILGDVFHREALKSAHVALMDIDETRLEESHIVVRKLMDSA
GASGRITCHTNQKAALQDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGI
MRALRTIPHLWRICEDMTEVCPKATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTA
EELARDLNIDPTSLRYRCAGINHMAFYLELERKTADGTYVNLYPELLAAYDAGQAPKPNI
HGNERCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLIARYKVPLDEYPKRCV
EQLANWHKELEEYKTAERIDIKPSREYASTIMNALWTGEPSVIYGNVRNEGLIDNLPQGS
CVEVACLVDANGIQPTKVGTIPSHLAAMMQTNINVQTLLTEAILTENRDRVYHAAMMDPH
TAAVLGIEEIYALVDDLIAAHGDWLPAWLRR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgatgacggcacccaaaattacctttatcggcgcaggttctacgattttcgtcaaaaat
atcctcggcgatgtgtttcaccgcgaggcgctaaagtcagcgcatgtcgccctgatggat
attgacgaaacccggctggaagagtcgcacattgtggtacggaaactgatggactcagcg
ggcgcttctggccggattacctgccataccaaccagaaagcggcgctacaggatgcggat
ttcgtggtggtcgcctttcagattggcggctatgaaccctgcaccgtgaccgattttgag
gtttgtaagcgtcatggcctggaacagacgatcgccgatacgctggggccgggcggcatc
atgcgcgcgctgcggaccatcccgcatctgtggcggatttgcgaagacatgacggaagtc
tgtccgaaggccaccatgctcaattacgtcaacccgatggcgatgaatacctgggcgatg
tatgcccgttatccgcatatcaaacaggtcggcctgtgccattcggtacagggaacggcg
gaagaactggcgcgcgacctgaatatcgatcccacctcgctgcgctaccgctgcgccggc
attaaccacatggcgttttacctcgaactggagcgcaaaacggctgacgggacttatgtc
aatctctatcctgaattgctggcggcctatgacgccggacaggcgccgaagcccaatatt
cacggcaatgaacgctgccagaacatcgtgcgctatgagatgttcaaaaagttgggctac
ttcgtcactgagtcatcagagcattttgccgagtacacgccgtggtttattaaaccggga
cgcgaggatctgattgcgcgctacaaggtgccgctggatgaatatccgaaacgctgcgta
gaacaactggcgaactggcataaagagctggaggagtataaaaccgccgagcgtatcgac
atcaaaccgtcccgcgagtacgccagcaccattatgaacgctctgtggaccggcgagccg
agcgtgatttacggcaatgtgcgtaacgaggggctgattgataacctgccgcagggaagc
tgcgtggaagtggcttgtctggtggatgccaacggcattcaaccgacgaaggtggggacg
atcccttcccatctggcggcgatgatgcagaccaacatcaacgtgcaaacgctgttgacc
gaagccatcctcacggaaaaccgcgatcgcgtgtatcacgcggcgatgatggaccctcat
accgcagcggtgctgggtatcgaagaaatctatgcgttggttgacgatctgatcgccgcg
catggcgactggcttccggcctggttacgccgttaa

DBGET integrated database retrieval system