KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A4971Help
Entry
SeD_A4971         CDS       T00757                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III, psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00230  Purine metabolism
sed00240  Pyrimidine metabolism
sed01100  Metabolic pathways
sed03030  DNA replication
sed03430  Mismatch repair
sed03440  Homologous recombination
Module
sed_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SeD_A4971 (holD)
   00240 Pyrimidine metabolism
    SeD_A4971 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SeD_A4971 (holD)
   03430 Mismatch repair
    SeD_A4971 (holD)
   03440 Homologous recombination
    SeD_A4971 (holD)
Enzymes [BR:sed01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SeD_A4971 (holD)
DNA replication proteins [BR:sed03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SeD_A4971 (holD)
DNA repair and recombination proteins [BR:sed03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     SeD_A4971 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi
Motif
Other DBs
NCBI-ProteinID: ACH74572
Position
4801797..4802234
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRA
LTVSPDQVLPLAPERVAMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAA
LWQQICEHEHDFYPQHDRSPRSLAD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggtattacgcagtgggcgctgcga
cgtcctggcgcgctacagggcgagattgcgatttcccttcccgcgcacgttcgtctgatc
gtggttgcagaggaattacccgcgctgaacgagccgctaatgcgcgatattttacgcgcg
ttgaccgtgagtcccgatcaggttttacccctggcgcctgagcgcgtcgccatgctgccg
cagggcagccgttgtaatagctggcggttaggaactgacgcgccgctccaactcgaaggc
gctcaggtcacgacgccggcgtttaatgaactccgggcaaacccggcggcacgcgccgca
ctatggcaacaaatctgcgaacatgaacacgatttctatcctcagcacgaccgatctccc
cgcagcctggcagattga

DBGET integrated database retrieval system