KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A0004Help
Entry
SNSL254_A0004     CDS       T00739                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SNSL254_A0004 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SNSL254_A0004 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SNSL254_A0004 (thrC)
Enzymes [BR:see01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SNSL254_A0004 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3734..5020
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHELPEFSLTEIDEMLNQDFVSRSAKILS
AFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQICYYFEAVAQLPQGARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGKWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTMRELKAKGYISEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEALAERADLPLLSHHLPADFAAL
RKLMMTRQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctataatctgaaagaccataatgagcaggtcagctttgcgcaggccgtcacg
caaggactgggcaaacagcagggacttttttttccgcacgaactgccggagtttagcctg
acggaaattgatgagatgctcaaccaggactttgtcagccgtagcgcaaagatcctctcg
gcatttattggcgatgaaataccgcagcaaattctggaagagcgcgtccgcgcggcgttt
gcgttcccggcgccggtagcgcaggtagaaagcgatgtcggctgcctggagctgttccat
ggtccgacgctggcctttaaagacttcggcgggcgttttatggcgcaaatgctgacgcat
atcagcggcgacaaaccggtgacgattctgaccgcaacgtcaggcgataccggcgcggcg
gtggctcacgcgttctatggcctggaaaatgtgcgggtcgtcattctctacccgcgcggt
aaaatcagtccgttgcaggaaaaactgttctgtacgctgggcggcaacattgaaaccgtg
gcgatcgacggcgatttcgacgcttgccaggcgctggtgaaacaggcatttgatgacgaa
gaactgaaaacggcgctggggctgaattcagctaattcgattaatatcagccgcctgttg
gcgcaaatttgctactactttgaagccgtggcgcaattgccgcagggggcgcgtaaccaa
ctggtgatctctgtacccagcggcaactttggtgatttgacggcaggactgctggcgaag
tcgttaggcctaccggtgaaacgttttatcgccgccaccaacgtcaacgacacggtgccg
cgtttcctgcatgacgggaagtgggcgccgaaagcgacgcaggcgaccctgtcgaatgcg
atggatgtcagccagccgaataactggccgcgcgtggaggagctattccgccgtaaaatc
tggcgtctgactgagctgggctatgcggcggtggatgacactacgacacaacagacgatg
cgcgagctgaaagcgaaaggttatatctcggaacctcatgcagcggtagcgtatcgggca
ttacgcgaccagttaaaccctggcgagtatggcttgtttctcggaacggcgcatccggcg
aagtttaaagaaagcgtggagtccattctgggagaaacgctggccttgcctgaagcgctc
gccgaacgcgccgacctgccgctgctttcacatcatctgcctgcggattttgccgccctg
cgtaagctgatgatgacccgccagtaa

DBGET integrated database retrieval system