KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A0166Help
Entry
SNSL254_A0166     CDS       T00739                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see00010  Glycolysis / Gluconeogenesis
see00020  Citrate cycle (TCA cycle)
see00620  Pyruvate metabolism
see01100  Metabolic pathways
see01110  Biosynthesis of secondary metabolites
see01120  Microbial metabolism in diverse environments
see01130  Biosynthesis of antibiotics
see01200  Carbon metabolism
Module
see_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNSL254_A0166 (aceF)
   00020 Citrate cycle (TCA cycle)
    SNSL254_A0166 (aceF)
   00620 Pyruvate metabolism
    SNSL254_A0166 (aceF)
Enzymes [BR:see01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SNSL254_A0166 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H NQRA HlyD_D23 HlyD_3 DUF1223
Motif
Other DBs
NCBI-ProteinID: ACF63782
UniProt: A0A0H3BQR8
Position
180699..182588
Genome map
AA seq 629 aa AA seqDB search
MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGALIMIFDSADGAADAAPAKAEEKKEAAPAAAPAAAAAKDVHVPDIGSDEVEV
TEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNTGDKVSTGSLIMVFEVA
GEAGAAAPAKAEAAPAAAAPAAATGVKDVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLIT
VEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAPAKQEAAAPAPA
AKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDV
QAYVKDAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWV
MIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFNSSL
SEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSVTELSRELTTISKKARDGKLTAG
EMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSF
DHRVIDGADGARFITIINNMLSDIRRLVM
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcgggacagatgaagttgaaatcaccgagatt
ctggtcaaagtgggcgacaaagttgaagctgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagtcccgtctccgcaggctggcgtcgtgaaagagatcaaagtctct
gtcggcgacaaaaccgagaccggtgcacttatcatgattttcgattccgccgacggtgca
gctgacgctgcacctgctaaggcagaagagaagaaagaagcggctccggcagcagcacct
gctgcggcagcggcgaaagacgttcacgttccggatatcggcagtgacgaagttgaagtg
actgaagtgatggtgaaagtgggcgacaccgtagaagctgaacagtcgctgatcaccgtc
gaaggcgacaaggcctctatggaagttcctgctccgtttgcaggcaccgtgaaagagatc
aaagtgaacaccggcgacaaagtctctaccggctctctgattatggtcttcgaagtggcg
ggtgaagcaggcgcagcagcaccagcgaaagcggaagccgctccggctgcggctgctcca
gcagcagcgacgggcgtgaaagacgttaacgtaccggacatcggcggtgacgaagttgaa
gtcaccgaagtgatggtcaaagtcggcgataaagttgccgctgaacagtcgctgatcacc
gtcgaaggcgacaaagcctccatggaagtgcctgcgccgttcgcgggcaccgtgaaagaa
atcaaaatcagcaccggcgataaagtgaaaaccggttctctgattatggtcttcgaagta
gaaggcgcagcgcctgcggccgctccggctaaacaggaagcggcggcaccggctccggcg
gcgaaagctgagaagcctgctgccccggctgccaaagcggaaggcaaatctgagttcgct
gaaaacgacgcttacgttcacgctaccccgctgattcgccgcctggcgcgcgagtttggc
gtcaacctggcgaaagtgaaaggcaccggtcgtaaaggccgtattctgcgcgaagacgtt
caggcttacgtgaaagacgcaatcaaacgcgcggaagctgcgccggctgctgcgggcggt
ggtatcccgggtatgctgccgtggccgaaagtggacttcagcaagtttggtgaagttgaa
gaagtggaactgggccgtatccagaaaatctctggcgcgaacctgagccgtaactgggtg
atgatcccgcacgttacgcacttcgacaaaaccgatatcaccgatctggaagcgttccgt
aaacagcagaacgccgaagctgagaagcgcaaactggatgtgaaatacacgccagtggtc
ttcatcatgaaagcggttgccgctgctctggaacagatgccgcgcttcaacagctctctg
tccgaagacggtcagcgtctgaccctgaaaaaatacatcaacatcggcgtggcggttgat
accccgaatggcctggtggttccggtctttaaagacgtgaataagaagagcgtgaccgag
ctgtctcgtgaactgaccaccatctccaaaaaagcgcgtgatggtaagctgaccgctggc
gaaatgcagggtggttgcttcactatctccagcatcggcggcctgggaactacccacttc
gcgccgattgttaacgcgccggaagtggctatcctcggcgtttctaagtcggcgatggag
ccggtgtggaatgggaaagagtttgtgccgcgtctgatgatgcctatctctctttccttc
gaccaccgtgtgatcgatggtgctgatggtgcgcgtttcattaccattatcaacaatatg
ttgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system