KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A0398Help
Entry
SNSL254_A0398     CDS       T00739                                 

Definition
type III restriction-modification system StyLTI enzyme res (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Brite
Enzymes [BR:see01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     SNSL254_A0398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
409761..412730
Genome map
AA seq 989 aa AA seqDB search
MNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKERYDDKANIDVKMETGTGK
TYVYTRLMYELHQKYGLFKFVLVVPTPAIKEGARNFITSDYARQHFSQFYENTRMELCTI
NAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQMLNSASMTRDDYDQTLLGGL
TSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMIVRFGATFPDIVEGKGKNKCV
RKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPEEQANNRYIVDSVTAKKLILRRGSK
IAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLELEAGMALVPGTFGASYQELIIQDAID
KHFDTEQANFLRSNEPENNAPRIKTLSLFFIDSIKSYRDDEGWLKLKFECLLKKKLTQLI
DDYQRKTLPREVEYLSFLQATLASLHSDNQNVHAGYFGEDRGSGDEAIQAEVDDILKNKE
KLLSFSDHHGNWETRRFLFSKWTLREGWDNPNVFVIAKLRSSGSESSKIQEVGRGLRLPV
DENGHRVHQEEWPSRLSFLIGYDEKAFASMLVDEINRDSKVQLNEQKLDEAMITLIVTER
QKVDPAFTELRLLEDLDDKKLINRSNEFKPSVTLNGETKSGFAWLLEFYPELTQARVRAD
RIRDNKPASRLRVRLRKENWEQLSSIWEQFSRRYMLQFERSGASLEQIAAEVLRDPALYI
RQKPSQVQQRLVSNEDNGRFEVAQREGELAASEFMAGMKYGHFLKQLALRTSLPVNVLHP
VLMAMLRDVLHGDSRYLSEISLDNMTRALQTRINAHFAQRHDYLPLDFQASTSVFDSTAR
QFREEISAEIVGKNVDENAIDDPRSLYQIPPLRYDSVDPELPLLKYDYPQQVSVFGKLPK
RAIQIPKYTGGSTTPDFVYRIERQDADSVYLLVETKAENMRVGDQVILDAQRKFFDMLRR
QNINVEFAEATSAPAVFSTINGLIEGKAN
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttactggaagaacttccccatcaggaacaggcgttagcggcgattctggcg
agtttcaccggtatcgatcacgcgcaggccgatcataatcactatgctaatccgctgatt
aaggaacgttacgacgataaggccaatattgacgttaaaatggagaccgggacgggcaaa
acctatgtctatacccggttgatgtatgaactgcatcagaagtatggcctcttcaaattt
gtgctggtggtgccgacgccagccattaaagaaggcgcgcggaactttattaccagcgat
tacgccagacagcatttttcacagttctacgaaaatacgcggatggaactttgcaccatc
aacgccggtgattttaaagtaaagtcggggcgtaaaaattttccggcccagttattaagt
tttactgatgccagccgtcgtgatagccatacgattcaggttttgctgatcaatgcgcaa
atgctcaattccgccagtatgacgcgagacgattacgatcaaacgctactgggcgggctg
acgtcgcctgttaaagggctgcaaatgacgcgaccggtggtcattattgatgaaccgcat
cgttttgcgcgagataacaaattttatcgagcgattcaggctattcagccgcaaatgatc
gtccgctttggcgctaccttcccggatattgtcgaaggtaagggtaaaaataaatgtgta
cgtaaagattactatcgccggcaaccgcagtttgatctcaacgcggtggacagttttaac
gatggtttggtgaaaggtattgatatttattacccgaatctccccgaagaacaggccaac
aatcgttatatcgttgacagcgtcacggcaaagaaattaatcctccgacgggggagcaaa
attgccgaggttggcgtgggcgaaaatctcgccgatgtcgatgcaggatttgaaggcagt
attgaatatgccggcagtaaaatgttgtcgaacgatctggagctggaggcagggatggcg
ctggtgccaggaacctttggcgcgagctaccaggaactgattattcaggacgccattgat
aagcattttgataccgagcaggcaaatttcttacgcagcaatgagccagaaaataatgcc
ccgcgtattaagacattaagccttttctttattgacagtattaaaagctatcgtgatgac
gaaggttggttgaaactgaagtttgagtgtttactgaaaaagaaactgacgcaactgatt
gacgattatcagcgcaagaccctgccgcgagaagtggagtatctgtcgtttctgcaggcc
acgctcgccagcctgcactcggataaccaaaacgtccacgctggttactttggcgaagac
cgcggaagcggcgatgaggcgatccaggctgaggtagatgatattctgaaaaataaagag
aagttgctcagtttttcagaccatcacggcaactgggaaacgcgccgctttctgttttca
aaatggacgcttcgcgaaggctgggataacccgaatgtttttgtcattgctaaattacgt
tcttccggtagcgagtcgagcaaaattcaggaagtggggcgcggcctgcggctaccggta
gatgaaaacggccatcgcgttcatcaggaagagtggccgtcccgactgtcgtttctgatt
ggttatgatgaaaaagcgtttgccagtatgctggttgatgagattaatcgcgacagcaaa
gttcagcttaacgagcagaaactggatgaggcgatgatcacactcatcgtcaccgagcgg
caaaaagtcgatcctgcgtttacggagcttcgtttgctggaagatctggatgataaaaaa
ctgatcaaccggagtaatgagtttaaacccagcgtcacgcttaacggggaaaccaaaagt
ggttttgcgtggctactggagttctaccctgagctgacgcaggcgcgggtgcgagcggat
cgcattcgtgacaataagcccgcctcccgactgcgagtcaggttacgcaaagagaattgg
gaacaacttagcagtatctgggagcagttttcccgccgttatatgctgcaattcgagcgt
agcggcgcgtctctggaacagattgccgccgaggtgctgcgcgatccggcgctgtatata
cgccagaagccaagccaggttcaacaacggctggtatcgaatgaagataatggccgtttt
gaagtggcgcagcgggaaggcgaattagccgccagcgaatttatggcgggcatgaaatat
ggccattttcttaagcaactggcgttacgcaccagtctgccggttaacgtcctgcatccg
gtgttaatggcgatgctgcgtgatgttttgcacggagattcacgctatttaagcgagatc
tcgttggacaatatgacccgcgcattacagacgcggattaatgcgcattttgcgcagcgc
cacgattatctgcctctcgattttcaggcttcaacgtcggtatttgattccacggcacgg
cagttcagagaggagattagcgctgaaattgtgggaaaaaatgtggatgagaatgcgata
gacgatcctcgttctctctatcaaataccgccgttgcgttatgacagcgtcgatccagaa
ttgccgctattaaaatacgattatccgcaacaggtttctgtgtttggcaaactgcctaag
cgggccattcagatccccaaatatacggggggctctactacgccggattttgtgtaccgt
attgagcgtcaggacgccgacagcgtttatttactggttgaaactaaagcagaaaatatg
cgcgtaggcgatcaggttattcttgatgcgcaacgtaaattcttcgatatgctgcgtcgg
caaaatatcaatgtcgagtttgcggaagcgaccagcgcgccggcggtattttctaccatc
aatggcttgattgaggggaaggcaaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system