KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A0412Help
Entry
SNSL254_A0412     CDS       T00739                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see00860  Porphyrin and chlorophyll metabolism
see01100  Metabolic pathways
see01110  Biosynthesis of secondary metabolites
see01120  Microbial metabolism in diverse environments
Module
see_M00121  Heme biosynthesis, glutamate => heme
see_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SNSL254_A0412 (hemB)
Enzymes [BR:see01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SNSL254_A0412 (hemB)
Exosome [BR:see04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SNSL254_A0412 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACF61481
UniProt: A0A0H3BKV4
Position
complement(428136..429110)
Genome map
AA seq 324 aa AA seqDB search
MTDLIHRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDYKAIDAMPGVMRIPEKQ
LAREIERIANAGIRSVMTFGISHHTDDTGSDTWKEDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLANLGKQAVIAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDVLREIRERTELPLGAYQVSGEYAMIKFAAMAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKNILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccttatccatcgccctcgccgcctgcgcaaatccgctgcgctgcgcgctatg
tttgaagagacaacacttagcctgaacgacctggtgttgccgatctttgttgaagaagaa
ctcgacgattacaaagctattgatgccatgcccggcgtaatgcgtatcccggaaaagcag
ctggcgcgagagattgaacgtatcgcaaatgctggtattcgttccgttatgaccttcggc
atttctcaccatactgatgacaccggcagcgatacctggaaagaagacggtctggtggca
agaatgtcccgcatctgtaagcaaaccgtgccggagatgatcgtcatgtccgacacctgc
ttctgcgaatacacctcgcacggccactgcggcgtgttgtgcgaacacggcgtggataac
gatgcgacgctggccaacctcggcaagcaggccgttatcgcggcggcggctggagcagat
tttattgcgccctccgcggcaatggatggacaagtccaggctatccgccaggcgctggat
gccgccggttttaccgatacggcaataatgtcctactccaccaagttcgcctcttctttc
tacggccccttccgtgaagcagcgggcaccgcgttaaaaggcgaccgcaagacgtatcaa
atgaatccgatgaaccgccgtgaagcgattcgcgaatcactgctcgacgaagcccagggc
gcggattgcttaatggtgaaaccggccggcgcgtatctggacgtgctgcgtgaaatccgc
gaacgcacagagttgccgcttggcgcttaccaggtgagcggtgaatacgccatgattaaa
tttgctgctatggctggcgccatcgatgaagaaaaggtcgtgctggaaagtctgggctcg
attaaacgcgccggcgccgatttgattttcagttacttcgcgctggatctggctgagaaa
aatattctgcgttaa

DBGET integrated database retrieval system