KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A0792Help
Entry
SNSL254_A0792     CDS       T00739                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see00020  Citrate cycle (TCA cycle)
see00190  Oxidative phosphorylation
see00650  Butanoate metabolism
see01100  Metabolic pathways
see01110  Biosynthesis of secondary metabolites
see01120  Microbial metabolism in diverse environments
see01130  Biosynthesis of antibiotics
see01200  Carbon metabolism
Module
see_M00009  Citrate cycle (TCA cycle, Krebs cycle)
see_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
see_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SNSL254_A0792 (sdhD)
   00650 Butanoate metabolism
    SNSL254_A0792 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SNSL254_A0792 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACF62252
UniProt: A0A0H3BQ07
Position
802986..803333
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEAWTGFFSSAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLAVRLILQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgacttcatcctggtccgt
gctaccgctatcgttctgacgttatacatcatctacatggtgggttttttcgccacgagc
ggcgaactgacctttgaagcctggaccggtttcttctcatcggccttcaccaaagtcttc
accctgctggcgcttttttccatcttgattcatgcctggatcggcatgtggcaggtgtta
accgactacgttaaaccactggcagtgcgtctgatactgcaactcgttattgttgttgcg
ctggtggtttacgtcatctatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system