KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A1150Help
Entry
SNSL254_A1150     CDS       T00739                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Brite
Enzymes [BR:see01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SNSL254_A1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1150696..1151235
Genome map
AA seq 179 aa AA seqDB search
MAHRTKVKYGLSAAMLALIAAGASAPQLLDQFLQEREGNTLVAVRDNGGVWSVCRGVTHI
DGKPVVKGQRLTQSQCDHYNAIERDKALAWVNKHVHIPLTEPQKAGIASFCPYNIGPGKC
FPSTFYRKLNAGDRKGACAEIRRWVYDGGKDCRNRENQCYGQVIRRDQESALACWGIDQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacaggacaaaagttaaatacggtctttccgccgccatgctggcgctgattgcc
gccggtgccagcgcaccgcaactactcgaccagtttttgcaggagcgggaaggaaatacg
ctggtggccgttcgtgataacggaggcgtctggtcagtatgccgtggcgtgactcatatc
gatggtaaacccgttgtgaaaggccagcgactgacacaaagccagtgcgaccattacaac
gccatcgagcgggataaagcgctggcatgggtaaataaacatgttcacataccgctgacc
gaaccgcagaaagccggtattgcgtcgttctgtccgtataacatcggtcccggtaaatgt
ttcccgtccacgttttaccggaagctcaacgcaggagatcgcaaaggagcgtgtgcagaa
atccgccgttgggtatatgacggcggcaaagactgccgcaacagggaaaatcagtgttac
ggccaggtgatacgacgcgaccaggaatcggcgctggcgtgctggggtattgatcaataa

DBGET integrated database retrieval system