KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A1308Help
Entry
SNSL254_A1308     CDS       T00739                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:see00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:see00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1294391..1295416
Genome map
AA seq 341 aa AA seqDB search
MGPVMLNVEGCELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVRQIRAASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFFALHGLEEGGRLAQEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHADPAKALAMATRFIDGMHDAGMKTTGKHFPGHGAVTADSHKETP
CDPRPETDIRGKDMSVFRTLISENKLDAIMPAHVIYRAIDPRPASGSPYWLKTVLRQELG
FDGVIFSDDLSMEGAAIMGSYAERAQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TRLYHKGSFSRRELMDSARWKTASAQLNQLHERWQEEKAGH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccagtaatgttgaatgtcgaaggatgtgagctggatgcggaggagcgcgagata
ctggcgcatccgctggttggcgggcttattctgttcacgcgtaattaccatgacccggaa
cagctgcgcgaattagtgcgccagattcgggcggcatcgcgtaaccatctggtggtggcc
gtcgatcaggaaggcgggcgcgtacagcgtttccgtgaagggtttacccgcctgcccgcg
gcgcaatctttttttgcgctgcatgggctggaagagggggggcgactggcgcaggaggca
gggtggctgatggccagcgaaatgatcgcgatggatattgatatcagttttgcgccagtg
ctggatgtcgggcatatcagcgcggcaattggcgagcgttcttatcatgccgatccagca
aaagcgttggcaatggcaacgcgctttattgacggcatgcatgacgccgggatgaaaacg
accggtaagcatttccccggccacggcgcggtcacggcggactcccacaaagagacgccg
tgcgatccacgtcctgaaacggacatccgtggcaaagatatgtcggtgttccgcacgctg
attagcgagaataaactggatgcgattatgcctgcccacgtgatctaccgcgctatcgat
ccgcgtccggcaagcggttcgccgtactggctgaaaacggtgctgcgtcaggagttaggc
tttgatggcgtcattttctccgacgatctgtcgatggagggcgcggcgattatgggcagc
tatgctgagcgcgctcaggcgtcgctggatgcgggttgcgatatgattctggtctgcaat
aatcgtaaaggcgcagtcagcgtgctggataatctgtcgccgatcaaagcagaacgtgtt
acacgtttgtatcataaaggttcattttcacgccgggagctcatggactcagcacgctgg
aaaacagccagcgcccagctcaaccagttacatgaacgctggcaggaagaaaaagcaggt
cattaa

DBGET integrated database retrieval system