KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A1852Help
Entry
SNSL254_A1852     CDS       T00739                                 

Definition
(RefSeq) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
  KO
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SNSL254_A1852
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SNSL254_A1852
Enzymes [BR:see01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SNSL254_A1852
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SNSL254_A1852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1818060..1819418
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIASIYQHYASAISVLTDEKYFQGSFDFLPVVSQSAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLSAVAHSLKMGVLTEVSNDEERERAIALGAKV
VGINNRDLRDLSIDLNRTRQLAPKLGHGVTVISESGINTYGQVRELSHFANGFLIGSALM
AHDDLNAAVRRVLLGENKVCGLTRVQDAKAACDAGAIYGGLIFVPSSPRAVSVEQAREVI
SGAPLQYVGVFQNADIADVCQKAAVLSLSAVQLHGSEDQAYVNALREALPKQVQIWKALS
VSDALPARDYHHVDKYVFDNGQGGSGQRFDWSLLQGQPLDNVLLAGGLAADNCVQAAQVG
CAGLDFNSGVESQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaagcccgcaaa
cagcaacagccgctggccagttttcaaaatgagatccagccaagtacacgccatttttat
gatgcgctccagggcgcgcgtaccgcctttattctggagtgtaagaaagcatcgccatca
aaaggcgtgattcgcgatgatttcgatccggcgcgtattgccagtatttatcaacattac
gcctcggcaatctcggtgctcaccgacgaaaaatattttcaggggagcttcgattttctg
ccggtcgttagccaaagcgcgccgcagccgattctgtgtaaggattttattatcgatccc
tatcagatctaccttgcccgttactatcaggccgatgcctgtttactgatgctctcggtt
ctggatgacgaacagtatcgccagctctccgccgtcgcgcacagtctgaaaatgggcgtg
ctcacggaggtcagtaatgacgaagaacgggagcgcgcgatagcgttaggcgcaaaagtg
gtaggtatcaacaatcgcgatctgcgcgatctgtcgattgatttgaatcgcacccgccag
ctggcgccaaaactgggccacggcgtgactgtcatcagcgagtccgggattaacacctat
ggtcaggtacgcgaactgagccacttcgccaacggttttttaattggctcggcgttaatg
gcgcatgacgatcttaacgccgccgtccgtcgcgtgctgcttggcgaaaataaagtctgc
ggcctgacccgcgtccaggacgctaaagcggcctgtgacgctggcgcaatatatggcggg
ttgatttttgtgccctcatctccacgcgcggtgagcgttgagcaggcgcgagaagtgata
agcggcgcgccattgcagtatgtcggcgttttccagaacgctgatatcgccgatgtttgc
cagaaagccgccgtcctgtcgctttctgccgtacagctacatggcagcgaagaccaggcg
tatgtcaacgcgctgcgcgaggcgttgccgaaacaggtgcaaatctggaaggcgctgagc
gttagcgatgcccttcccgcacgcgattatcaccatgtcgataaatacgttttcgacaat
gggcaaggcggcagcgggcagcgcttcgactggtcactgctacaggggcaaccactggat
aatgtgttactggcgggcgggctggcggccgataactgcgtccaggcggcgcaagtcggc
tgtgccggtctcgattttaattcaggtgtggagtcacagccgggcatcaaagatgctcgt
cttctggcctcggtttttcagacactgcgcgcatattaa

DBGET integrated database retrieval system