KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A1853Help
Entry
SNSL254_A1853     CDS       T00739                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see00260  Glycine, serine and threonine metabolism
see00400  Phenylalanine, tyrosine and tryptophan biosynthesis
see01100  Metabolic pathways
see01110  Biosynthesis of secondary metabolites
see01130  Biosynthesis of antibiotics
see01230  Biosynthesis of amino acids
Module
see_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SNSL254_A1853 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SNSL254_A1853 (trpB)
Enzymes [BR:see01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SNSL254_A1853 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACF64937
UniProt: B4T6X1
Structure
PDB: 

Jmol
Position
1819428..1820621
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQKDPEFQAQFADLLKNYAGRPTALT
KCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGM
FADFINDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSI
SAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALK
MMREQPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacttctcaacccctactttggtgaattcggcggcatgtatgtgccgcagatc
ctgatgcctgcgctgaaccagcttgaagaggccttcgtcagcgcgcaaaaagatcctgaa
tttcaggcgcaattcgccgatctgctaaaaaactacgcgggacgccccaccgcgctgacg
aaatgccagaacattaccgccggtacgcgtaccacgttgtatttaaagcgcgaagattta
ctgcacggcggcgcacacaaaaccaatcaggtactgggtcaggcgctgctggccaaacgg
atgggtaaaagcgagattatcgctgaaaccggcgccggtcagcacggcgtcgcctctgcg
ctcgccagcgccctgctgggtctgaaatgccgtatctatatgggtgccaaagacgttgag
cgccagtcgccgaacgtcttccgtatgcgtctgatgggcgctgaggttatcccggttcat
agcggctccgctacgctaaaagatgcctgtaacgaggcgctgcgcgactggtccggtagt
tacgaaaccgcgcactatatgctcggcacggcggcaggaccgcatccctatcccaccatc
gttcgcgagttccaacgcatgattggcgaagagacgaaagcgcaaatcctcgacaaagag
ggccgtctgccagatgccgttatcgcttgcgtcggcggcggctcaaacgctatcgggatg
tttgcggattttattaatgataccagcgtcgggctaataggcgttgaacctggcggtcac
ggtattgaaaccggcgagcatggcgcgccgcttaaacatggtcgcgttggcatctatttc
gggatgaaagcgccgatgatgcaaacagcggacgggcaaattgaagagtcatattccatt
tccgccgggctcgatttcccatccgttgggccgcaacatgcgtacctgaacagcatcgga
cgcgcggattatgtctccattaccgatgatgaggcgctggaagccttcaaaacgttgtgc
cgccatgagggaattatcccggcgctggaatcctcccacgcgttggcgcacgctctgaaa
atgatgcgcgagcagccggaaaaagagcaactgctggtggtcaatctctctggccgcgga
gataaagacatctttaccgtacacgatatcctgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system