KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A1879Help
Entry
SNSL254_A1879     CDS       T00739                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see00040  Pentose and glucuronate interconversions
see00052  Galactose metabolism
see00500  Starch and sucrose metabolism
see00520  Amino sugar and nucleotide sugar metabolism
see01100  Metabolic pathways
see01130  Biosynthesis of antibiotics
Module
see_M00362  Nucleotide sugar biosynthesis, prokaryotes
see_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SNSL254_A1879 (galU)
   00052 Galactose metabolism
    SNSL254_A1879 (galU)
   00500 Starch and sucrose metabolism
    SNSL254_A1879 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SNSL254_A1879 (galU)
Enzymes [BR:see01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SNSL254_A1879 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACF61430
UniProt: A0A0H3BKR2
Position
complement(1844169..1845077)
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGNEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGNSQIMVEPVEDVTAYGV
VDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWALLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNSLGAEFKAWLEEEMGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccttaattcgaaagtcaaaaaagccgttatcccggtcgcgggattgggaacc
aggatgctgccagcgaccaaagctatcccgaaagagatgctgccgctggttgataagcca
ttaattcagtacgtcgtgaacgaatgtatcgctgctggcattactgaaatcgtgctggtt
acgcactcgtctaaaaactctattgaaaaccactttgataccagttttgagctggaagcg
atgctggaaaaacgcgttaagcgtcagcttctggaggaggttcagtctatttgccctccg
catgtcactattatgcaggtacgtcaagggctggcaaaaggcctgggccatgccgtattg
tgcgcgcatcccgttgtcggaaacgaacctgttgctgttattctgccagacgttattctt
gacgaatatgagtccgacctgtctcaggataacctggctgaaatgatccgccgtttcgat
gaaaccggcaatagccagattatggttgagccggtagaagatgtgactgcatacggcgtg
gtcgattgtaaaggcgttgagctggcgccgggcgaaagtgtgccgatggttggcgtggtt
gaaaaaccaaaagcggatgtcgcgccgtctaaccttgcgattgtcgggcgttatgtgttg
agcgcggatatctgggcgttgctggcgaaaacccctccgggcgccggggatgaaattcag
ttgaccgatgctatcgatatgctgatcgaaaaagaaacggttgaagcctaccacatgaag
ggtaaaagccatgactgtggtaataagttaggatatatgcaggcattcgttgaatatggc
atccgtcataattcgctgggtgctgaatttaaagcctggcttgaagaagaaatgggtatt
aagaagtaa

DBGET integrated database retrieval system