KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A1911Help
Entry
SNSL254_A1911     CDS       T00739                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:see00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1872826..1873674
Genome map
AA seq 282 aa AA seqDB search
MTHWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLHIEPRHDGEIHLLTPVNGVE
NEDNLIVRAARLLMKVASESGRLPAGSGADISIEKRLPMGGGLGGGSSNAATVLVALNHL
WQCGLSIDELATLGLTLGADVPVFVRGHAAFAEGVGEILTPVNPPEKWYLVAHPGVSIPT
PVIFKDPQLPRNTPKRSIDTLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGTG
ACVFAEFDTESCARQVLEQAPEWLNAFVAKGVNLSPLHRELL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacccattggccttctccggcaaaattaaatctgtttttatatatcaccggacagcga
gcagacggctaccacacgctgcagacgctgtttcagtttctggattatggcgacacactc
cacatcgaaccgcgtcacgatggcgaaatccatttattaacgccggttaacggcgttgaa
aatgaagacaatctgatcgtccgtgccgcgcggctgttgatgaaagtcgcctcggagagt
gggcgcctgcccgccggaagcggtgcggatatcagcattgagaagcgccttcccatgggc
ggcggtctgggcggcggctcatctaacgccgcgaccgttctggtggcgctcaatcatctt
tggcaatgcgggctttccattgatgaactggcgacgctcggcctgacgctcggcgccgac
gtcccggtctttgttcgtggccacgccgcgtttgccgaaggcgtaggcgaaatattaacg
ccggtgaatccgccggaaaaatggtatctggtcgcgcaccctggcgtaagcattcccaca
ccggttatctttaaagatcctcaattgccgcgtaatacgccaaaaaggtcaatagatacg
ttactaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgcgag
gttgatgcggcgctttcctggctgttagaatacgcgccgtcgcgcctgactgggacaggg
gcctgtgtctttgctgaattcgatacagagtcttgtgctcgccaggtgcttgagcaagcc
ccggaatggctcaatgcttttgtggcgaagggtgtcaacctctccccattgcatcgagag
ttactctaa

DBGET integrated database retrieval system