KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A2280Help
Entry
SNSL254_A2280     CDS       T00739                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SNSL254_A2280 (galF)
   00052 Galactose metabolism
    SNSL254_A2280 (galF)
   00500 Starch and sucrose metabolism
    SNSL254_A2280 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    SNSL254_A2280 (galF)
Enzymes [BR:see01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SNSL254_A2280 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2190397..2191290)
Genome map
AA seq 297 aa AA seqDB search
MMNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPV
VGDNPFIVVLPDIIIDDATADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTK
EPLDNEGKVSRIVEFIEKPDQPQTLDSDLMAVGRYVLSVDIWAELERTEPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKSIEQLLHE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttgaaagcagttataccggtagcgggtttgggtatgcatatgttgcctgcc
accaaggcaatcccaaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gtcgatgagattgtggctgcagggatcaaagaaatcgtgctggtgactcacgcgtctaaa
aacgccgttgagaaccacttcgacacctcttatgaacttgaatcacttcttgagcagcgc
gttaagcgccagcttttggcggaagtgcaatctatctgcccaccgggcgtgacgattatg
aacgttcgccaggcgcagccgttagggctggggcactctattctgtgcgcgcgtccggtc
gtgggcgataaccctttcattgtggtactcccggatattattattgatgatgctaccgcc
gatccgctgcgctataaccttgcggcgatggtggcgcgtttcaatgaaacgggtcgcagc
caggtgctggcgaagcgcatgaaaggtgatttatcggagtattccgttatccagacgaaa
gaacctctggataatgaaggcaaagtcagccggattgtggagtttatcgaaaaaccggat
cagccgcagacgctggattccgatttgatggcggtaggccgttatgtgctttcagtcgac
atctgggcggaactggaaagaaccgaaccgggcgcctggggccgtatccagctcaccgat
gccattgcagaactggcgaaaaaacagtcggttgacgcgatgctaatgacgggtgacagc
tatgactgcggtaaaaaaatgggctacatgcaggcatttgtgaagtacgggctgcgcaac
ctgaaagaaggagccaagttccgtaagagcatagagcagcttttgcatgaataa

DBGET integrated database retrieval system