KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A2595Help
Entry
SNSL254_A2595     CDS       T00739                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
see00010  Glycolysis / Gluconeogenesis
see00052  Galactose metabolism
see00500  Starch and sucrose metabolism
see00520  Amino sugar and nucleotide sugar metabolism
see00521  Streptomycin biosynthesis
see01100  Metabolic pathways
see01110  Biosynthesis of secondary metabolites
see01120  Microbial metabolism in diverse environments
see01130  Biosynthesis of antibiotics
see01200  Carbon metabolism
Module
see_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
see_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNSL254_A2595 (glk)
   00052 Galactose metabolism
    SNSL254_A2595 (glk)
   00500 Starch and sucrose metabolism
    SNSL254_A2595 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SNSL254_A2595 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SNSL254_A2595 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SNSL254_A2595 (glk)
Enzymes [BR:see01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SNSL254_A2595 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: ACF65612
UniProt: B4SZS6
Position
complement(2516897..2517862)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVVRVYLDEHSVSVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDFAPNSEEEAMILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITERALADSCIDCRRALSLFCVI
MGRFGGDLALTMGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKDYVHGIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttagtaggagatgtaggcggcacgaatgcgcgtcttgccctgtgt
gatatcgccagtggagaaatctcgcaggccaaaacgtattccggcctggattatcccagt
cttgaggccgtggtgcgcgtttatctcgatgagcatagcgtcagcgtggaagatggttgt
atcgccatagcctgcccgattaccggcgactgggtggcgatgactaaccatacctgggct
ttttctattgcggaaatgaaaaaaaatctcggctttagtcatctggaaatcatcaacgat
ttcaccgccgtgtcgatggcgatcccgatgctgaaaaaagagcatttaattcagttcggc
ggcggcgaaccggtagacggcaaacctattgcggtgtacggcgcgggaaccggcttgggc
gtggcgcatctggtgcatgtggataagcgttggattagccttccgggcgaaggcgggcat
gtcgattttgcgcctaatagcgaagaagaagctatgattctggaaatattgcgcgccgaa
attggccacgtttccgccgagcgcgtgctgtctggcccggggctggtgaatctttaccgg
gcgattgttaagtccgacaaccgtctgccggaaaatctgcgcccgaaagatattaccgaa
cgcgccctggcggatagctgtatcgattgtcgccgcgcgttgtcgctcttttgcgtcatc
atggggcgatttggcggcgatctggcgttaaccatggggacatttggcggcgtttatatc
gctggcggtattgtcccgcgcttcctggaattttttaaagcgtccggcttccgtggtggc
tttgaagataaaggccgctttaaagattatgtacacggtattccggtctatctgattgtc
catgataatcctggcttgttaggttccggcgcgcatctgcgccagacattaggtcatatt
ctataa

DBGET integrated database retrieval system