KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A2676Help
Entry
SNSL254_A2676     CDS       T00739                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SNSL254_A2676 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    SNSL254_A2676 (dapE)
Enzymes [BR:see01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SNSL254_A2676 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2595035..2596162
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGDTQNFWAWRGRGET
LAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPH
HRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacagcaacttattcgtcgcccctccctgagtccg
gatgacgcaggctgtcaggcattaatgattgaacgcctgcgtaaaatcggttttaccatt
gagcatatggattttggcgacacgcaaaatttttgggcatggcgtgggcgtggcgaaacg
ctggcgttcgccgggcatactgacgtcgtaccggctggcgatgtcgatcgctggatcaat
ccgccgtttgaacctacgattcgcgacggaatgttgttcggtcgcggcgcggcggatatg
aaaggttcactggcggccatggtggtggctgctgaacgttttgttgcgcagcatcctcat
caccggggccgcctcgcgtttttgattacctctgatgaggaagccagcgcaaaaaatggc
accgtaaaggtggttgaagcgctgatggcccgtaacgagcggctggattactgtctggtc
ggcgaaccttccagtactgaaattgtgggcgatgtcgtcaaaaacgggcgtcgcggttcc
ctcacctgtaacctcactattcatggcgttcaggggcacgtcgcctatccgcatctggcg
gataaccctgttcatcgcgctgcgccttttctcaatgaactggtcgctatcgagtgggat
cggggcaatgactttttcccggccaccagtatgcaggtagccaatatccaggcaggcacc
ggcagcaataatgtcattcccggtgaactgttcgtgcagtttaacttccgtttcagcacg
gaactgaccgatgagatgatcaaagagcgggtacatgcgctgcttgagaagcatcagcta
cgctataccgtagactggtggctttccggccagccgttcctgaccgcacgcggcaagctg
gtggacgcggtggtaaacgccattgagcactataatgaaattaaaccgcaattactgacg
acgggcggtacgtccgacggacgttttatcgcccgtatgggagcgcaggtggtagaactg
gggccggtgaacgccaccattcataaaattaatgaatgtgtgaatgccgccgatctccag
ctactggcccgtatgtatcaacgcattatggaacagctcgtcgcctga

DBGET integrated database retrieval system