KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A3219Help
Entry
SNSL254_A3219     CDS       T00739                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:see00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SNSL254_A3219 (recD)
Enzymes [BR:see01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SNSL254_A3219 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3128614..3130449)
Genome map
AA seq 611 aa AA seqDB search
MTIQERLLEAVEQKLLRPIDAQFALTVAGNDDPAVTLAAALLSHDAGEGHVCLPLSRLTL
TEEAHPLLVAWISETPTPIDWKKRLLASAAVSCGDSPAPLILCGDRLYLNRMWCNERTVA
RFFNEVNQAIAVDEDQLSRILDALFPPTDEVNWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGAALRQLPLTDAQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPPHGRVIFLGDRDQ
LASVEAGAVLGDICAYVNAGFTAERARQLSRLTGSAIPAGAGTQAASLRDSLCLLQKSYR
FGSDSGIGKLAAAINCGDRSAIQAVFQQGFSDIEKRTLQSSDDYAGMLDEALAGYGRYLR
LLHEKATPEAILQAFNEYQLLCALREGPFGVRGLNDRIEQAMVQQRKIQRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGLRVWFVMPDGTIKSVQPSRLPEHDTTWAMTVHK
SQGSEFDHAALILPSQRSPVVTRELVYTAVTRARRRLSLYADERILAGAIVTRTERRSGL
ATLFDEVSRTG
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccaggagcggttgctggaggccgttgaacaaaaactattacggcccattgat
gcccagtttgctttaaccgtcgccggtaacgacgatcccgccgtgacgctggcggcagcg
ctgcttagtcatgacgcaggtgaaggtcacgtgtgtctgccgttgtcgcgtttaacgtta
acggaggaggcgcatcccttactggtcgcctggataagcgaaacgcctacgccaatcgac
tggaaaaagcggttactggcgtctgcggcggttagctgcggcgatagccccgcgccgtta
attctgtgcggcgatcgtctctacctgaatcgcatgtggtgcaacgaacgtacggttgcg
cgcttttttaacgaggttaaccaggccatcgccgtagatgaagatcagttatcccgtatt
ctggacgcgctattccctccgacagacgaggtgaactggcaaaaggtggccgccgccgta
gcgctaactcgccgtatctccgtgatttcaggcggtcccggcaccggtaaaaccaccacc
gtcgcgaagctgctggcggcattaattcaaatggcggatggcgaacgttgccgtatccgg
ctggcagcgccgaccgggaaagcggccgcacgcctgacggagtcgctcggcgcggcgttg
cgtcagcttccacttaccgatgcgcagaaaaagcgtataccggaggacgccagtacgctg
caccgactgctgggcgcacagcccggcagccagcgattacgccatcatgcgggcaacccg
ctgcatctggacgtgctggtggtcgatgaagcatcaatgattgatttgccgatgatgtca
cgtttgattgacgctctgccgccgcacgggcgggtcatttttcttggcgatcgcgatcag
ttggcatccgttgaggcgggcgctgtgttgggcgatatttgcgcctatgtcaacgcaggg
tttacggcggaacgcgcccgacagctaagtcgactaacagggagcgccattccggcgggg
gccggaacgcaagccgcgtctttacgcgatagcctctgtttgttgcaaaagagctaccgt
ttcggcagcgattctggcatcggcaagctggcggcggcgattaactgcggcgacaggtcg
gcaatccaggctgtttttcagcaggggtttagcgatatagagaagcgtacattgcaaagt
agcgacgattatgccgggatgctggatgaagcgctggcgggctatggtcgctacctgcgg
ttgctgcatgaaaaagcaacgccggaggcaatccttcaggctttcaatgagtatcaactg
ctttgcgcgctgcgcgaaggcccatttggcgtgaggggactgaatgaccgcattgagcag
gcgatggtgcagcaacgaaaaattcagcggcatccgcactctcgctggtatgaagggcgt
ccggtaatgattgcgcgcaacgatagcgcgttggggctatttaacggcgatattggtatt
gcgctcgatcgcggacaggggttacgcgtctggtttgtgatgccggacggcaccatcaag
tccgttcagcccagccgtctgccggaacatgatacaacctgggcgatgacggtacataaa
tcacaggggtctgaatttgatcacgccgcgctgattttacccagccagcgttcgccggtc
gtgacgcgggagctggtgtataccgctgttacgcgggcgcggcggcggttatcgctgtat
gccgatgaacggatcctggcaggcgcgattgtgacgcgtacggaacggcgcagcgggtta
gccaccttatttgatgaagtcagtcgtaccggataa

DBGET integrated database retrieval system