KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A4241Help
Entry
SNSL254_A4241     CDS       T00739                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SNSL254_A4241 (pldB)
Enzymes [BR:see01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SNSL254_A4241 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4130619..4131635
Genome map
AA seq 338 aa AA seqDB search
MFQQQNDWETRENAFAAFAMGPLTDFWRQREEAEFIGVGNIPVRFVRFRNDSNDRTIVIC
PGRIESYVKYAELAYDLFHLGFDIFIIDHRGQGRSGRMLSDPHRGHVDHFNDYVEDLAAF
WQQEIEPGPWRKRYILAHSMGGAIATLFLQRHRVRCDAIALTAPMFGIVIRLPSFMVRHI
LDWAEGHQRIREDYAIGTGQWRALPFGMNALTHSRQRYQRNLRFYADEPQLRVGGPTWHW
VREGILAGEQVLAGASDDTTPTLLIQAEEERVVDNRTHDRFCEIRAAAGYPCEGGKPLVI
KGAYHEILFEKDAMRSVALNAIVEFFNKPNLSSGNRFA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcagcaaaatgactgggaaacaagagaaaatgcgtttgccgcttttgctatg
gggccgctgaccgatttctggcgtcagcgggaagaggcggagtttatcggcgtgggtaac
attccggtgcgctttgtccgttttcgaaatgattccaacgatcggacgatcgtcatttgt
cctggccgcattgagagttatgtaaaatacgctgaactggcgtatgacctttttcatctc
ggttttgatatcttcatcatcgaccaccgtggtcaagggcgctccgggcggatgttatcg
gacccgcatcggggtcatgtcgatcattttaacgattatgttgaggacttagcggcgttc
tggcagcaggaaattgagccggggccgtggcgtaagcgttatatcctggcgcactcaatg
gggggcgcgatagccactctgttcctgcaacgccatcgtgtgcggtgcgacgctattgcg
ctcaccgcgccgatgtttggtattgtgatacgcttgccttcctttatggtgcgccatatt
ctcgactgggctgaagggcaccagcgtatccgtgaagattacgctattggtaccggtcag
tggcgggcgttgccgtttgggatgaatgcgctgacccacagccgccagcgttatcagcgc
aacttacgattttatgccgacgagccgcaactgcgcgttggcggccccacctggcattgg
gtacgcgaaggcattctggcgggtgagcaggtactggccggggcgagcgatgacacgacg
cctacgctattgattcaggcggaagaagagcgggtagtggataaccgcacccacgatcgt
ttttgtgaaattcgcgccgcggcgggatacccttgtgaagggggaaaaccgctggttatc
aaaggcgcgtaccatgagatcctttttgaaaaggacgccatgcgctcagtcgcgcttaac
gccattgttgaatttttcaacaagcctaatttatccagcggaaatcgctttgcttag

DBGET integrated database retrieval system